KEGG   Butyrate-producing bacterium SS3/4: CK3_00300Help
Entry
CK3_00300         CDS       T02611                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CK3_00300
Enzymes [BR:bprs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CK3_00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15374..16924
Genome map
AA seq 516 aa AA seqDB search
MVKDKQAGICRTEGDTNMKTMLERGAGILMPVSSLPSPYGIGTFGSAAYEFVDFLKKARQ
KYWQVLPVGPTSYGDSPYQSFSAFAGNPYFIDLDTLVKEGLLTQDEINACYWGDNPTQVA
YDAVFWYRFPLLKKAYARSEYREEQGYEKFCMDSWFWLNDYAFYMALKFHFDNKEWLAWP
EDIRFRKKEAVESYREELKDEIDFWKFLQYKFYQQWGKLRAYANEQGISIIGDIPIYVAL
DSADVWTHPELFLLDEENLTPLKVAGVPPDAFSETGQLWGNPLYRWDVQEKTDFAWWKER
MKASARLYDVVRIDHFIGVTQYYAIPAGSEDGKTGEWLKGPGKKLTDAINMVIGDTKIIA
EDLGIFVPEVKELLEETGYPGMKIIEFAFSGDRFNEHLPHMYSPNSVVYGGTHDNETLVG
YFKPEARQWWELQYIADYMGVSHQHEVVDKVLKTAYASVASVVIFQAQDILKLDSWARMN
TPGTVGNNWRWRMKPGELTQDHINHLSWLVDTFGRF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagataaacaggcggggatctgccggacagaaggggatacaaatatgaagaca
atgctggagcgcggagccggaattttaatgccggtgtcaagtttaccgtcaccttacggg
atcggtacatttggcagtgcggcctatgaattcgtggactttttaaaaaaggcaagacag
aaatactggcaggttctgccggtgggaccgacaagctacggggacagcccgtaccagtca
ttttccgcttttgcgggaaatccgtactttatcgatctggataccctggtgaaggaggga
cttctcacacaagacgagatcaacgcctgttactggggggataatccgacccaggtggcg
tacgacgcggtgttctggtaccggtttcccctgttgaaaaaggcgtacgcgagaagtgag
taccgcgaggaacagggctacgagaagttctgtatggacagctggttctggctgaatgat
tacgcattttacatggcgttaaagttccattttgataataaagaatggctggcatggccg
gaagatatccggttccggaagaaagaagcggtggagtcctaccgagaggaattgaaggac
gagatcgacttctggaagtttttacagtataaattctaccagcagtggggaaagctccgc
gcgtatgcgaacgagcagggaatctccatcatcggagatattccgatctacgtggcgctt
gacagtgcggacgtctggacccatccggagttattccttttggatgaggagaacctgacc
ccactcaaggttgccggagttccgccggacgccttcagtgagacgggacagctctggggc
aatccactttaccgatgggatgttcaggagaagactgatttcgcatggtggaaagagcgc
atgaaagcgtctgcccgcctgtatgacgtggtccgcatcgaccactttatcggtgtgacc
cagtattacgcgatcccggcgggttccgaggacggaaagaccggtgagtggttaaaggga
ccgggaaagaagcttacagatgccatcaacatggtcatcggtgacacgaagatcatcgcg
gaggatcttggaatctttgttccggaggtcaaggagcttcttgaggagacaggatatccg
ggaatgaagatcatcgagttcgccttcagcggcgaccgcttcaacgagcacctgccgcat
atgtactccccgaattccgtcgtttacggcggaacccatgacaacgagaccctggtgggc
tactttaagccggaggcgcgccagtggtgggagttgcagtatatcgcagactacatgggt
gtctcccatcagcatgaggtcgtagacaaggtcttaaagaccgcctacgcgtctgtagcc
agcgttgtgatcttccaggcgcaggatatcttaaagctcgatagctgggcgagaatgaac
acgccgggtacggtggggaataactggagatggagaatgaaaccgggcgagctgacgcag
gatcatatcaaccatctttcatggctggtcgatacattcggacggttttag

DBGET integrated database retrieval system