KEGG   Butyrate-producing bacterium SS3/4: CK3_04040Help
Entry
CK3_04040         CDS       T02611                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bprs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CK3_04040
Enzymes [BR:bprs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CK3_04040
Exosome [BR:bprs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CK3_04040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418977..421373
Genome map
AA seq 798 aa AA seqDB search
MEKILYDLMDWAGIEELVYSEASDPGRLLGEHVIKEGLLIQAFLPNAEKVSVKIGGELFP
MEMADENGFFAVLLEDRKELVPYHFCITYTDGDSEEIVDPYSYQFHTAFTEEEVRKFGAG
IYYDSYEKFGAHPAVEAGIEGVHFAVWAPDAMRVSVVGDFNFWDGRRHQMKKRGPSGIYE
IFIPNLKPGAIYKYEIKTKAGLPMLKADPYGNYAELRPNTASVVWDMSGYKWNDDEWIKE
RAAAKDRLKDSPMSIYEVHLGSWMQKTVAQNENGEDINGSQFYNYREIAEKLAAYVKEMG
YTHVELLPVMEHPLDESWGYQVTGYYAPTSRFGTPDDFKAFMDHMHKEGIGVILDWVPAH
FPRDAHGLAAFDGTCLYEHQDPRQGSHPHWGTLIYNYGRPQVSNFLISNALYWAKEFHAD
GIRMDAVASMLYLDYGKNAGEWVANIYGGNENLEAVEFLKHLNSIYARDTKGSVLIAEES
TAWPKVSGDENDGGLGFDFKWNMGWMNDFLDYMQCDPYFRHDHYGELTFSMLYAYSEKFV
LVFSHDEVVHGKGSLAGKMPGDTQEKKFANLRTAYGFMMGHPGKKLLFMGQDFGQMDEWN
EKASLEWGLLKYDIHSQMKDYVKALNHLYRTQPALYRMDYEPEGFEWINCTYNDENIVIF
ERKTEKPEETLLFVCNFAPVEHEKFRLGVPFAGKYKEILNSDAKQFGGSGMTNPRVKMSK
KEEWDTRKNSIAINLAPMSVAVFSCTPYEEEAEPEKKKTAEKRKRPARQPSVKLPASPLD
VISEKVGQIIKTARESRH
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatcttatatgatctgatggattgggccggaatcgaggaacttgtctattcc
gaggcgagcgatccgggacggcttttaggggaacatgtgataaaggaaggtcttctgatc
caggcttttctgccgaacgcggagaaggtgtccgtaaaaatcggcggggaattgttccca
atggaaatggcagacgagaacggctttttcgcggtgcttttagaagatcgaaaagaactg
gttccgtaccatttctgtatcacttacacagacggggacagcgaggaaatcgttgaccca
tacagctatcagttccacaccgcgtttacagaggaagaagtgcggaagttcggtgcgggg
atctattatgattcctatgagaaattcggggcacatccggcggtggaagccgggatcgag
ggcgttcactttgcggtgtgggcgccggatgcgatgcgcgtcagcgttgtgggcgatttc
aacttctgggacggaagacgccaccagatgaaaaagcgaggtccgtcggggatctacgag
atctttatcccgaacctgaagcccggcgcgatctacaaatatgagatcaagacaaaagca
ggacttccgatgctgaaggcggatccgtacggaaactatgcggagctccgcccgaatacg
gcatctgttgtctgggatatgtccggttacaaatggaacgatgatgagtggatcaaagag
cgggcagcggcgaaagaccgcctgaaggattccccgatgtccatctatgaggtccatctt
ggttcctggatgcagaaaacggtagcacagaatgagaacggtgaggacatcaacggcagc
cagttctacaactaccgggagatcgcggagaagctggcagcctatgtgaaagagatggga
tacacccatgtggagctgcttcctgtgatggaacatccgttggatgaatcctggggttac
caggttacaggctactacgcgccgacgagccgttttggaacaccagatgatttcaaggcg
tttatggatcatatgcacaaagaagggatcggtgtgatcctggactgggttccggcccat
tttccgcgggatgcccacggccttgcagcctttgacgggacatgcctctacgagcaccag
gatccgcgccagggatcccatccccactggggaacgctgatctacaattacggacgtccg
caggtatcaaacttcctgatctccaatgccttatactgggcgaaggagttccatgcagac
ggaattcggatggacgcagtggcatccatgctgtatctggactatggaaagaacgccggg
gagtgggtcgcaaacatttatggcggaaatgagaatctggaggcggtggaattcttaaag
catttaaattccatctatgcgagggacacgaaaggttctgtcctgatcgctgaagagtcc
acggcctggccgaaggtctccggtgatgagaacgatggcggacttggattcgacttcaag
tggaacatgggctggatgaacgatttcctggattacatgcagtgcgatccgtatttccgc
catgaccactacggggagctgaccttcagcatgctctacgcatacagtgaaaaatttgtt
ctggtattctcccatgacgaggtggtccacggaaaaggatccctggcaggtaagatgccg
ggggatacccaggagaagaagttcgcgaacctccgcaccgcctacggctttatgatgggt
catccgggaaagaaacttttgtttatgggacaggatttcggccagatggatgagtggaac
gagaaggcgagcctggagtggggactcttgaaatatgatatccacagccagatgaaggat
tatgtgaaagcactgaaccacttataccgcacacagccggcgctctacaggatggactac
gagccggagggcttcgagtggatcaactgcacatacaacgatgaaaatatcgttatattt
gagagaaaaacggaaaagccggaagagactctgctctttgtctgcaatttcgctccggtg
gagcatgagaagttccgtctcggcgttccgtttgcgggaaagtataaggagatcttaaac
agcgatgcgaagcagtttggcggcagcggaatgacgaacccgagggtcaagatgtcgaag
aaagaggagtgggatacgagaaagaactcgattgccatcaatcttgccccgatgtctgtg
gcggtattctcctgtaccccgtatgaagaagaggcagagccggaaaaaaagaaaacggcg
gagaagagaaagcgcccagcacggcagccatcggtaaagctgccggcgagtccgctggat
gtgatctctgagaaagttggacagatcataaagacggcgcgagagagccgacactga

DBGET integrated database retrieval system