KEGG   Butyrate-producing bacterium SS3/4: CK3_19240Help
Entry
CK3_19240         CDS       T02611                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CK3_19240
   00330 Arginine and proline metabolism
    CK3_19240
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CK3_19240
Enzymes [BR:bprs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CK3_19240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1963270..1964208
Genome map
AA seq 312 aa AA seqDB search
MLEEVAKDAWEYGRKFLLQGKVADYIPELGKANPVHFGLCIKTEDGRHIEFGDSECRFTI
QSICKIVSLAAALQYIGEEKVFKNVMMEPSGDAFNSILKLDTASNRPFNPMINAGAIEVV
SLLAGRFSFEKMLEFIRTLCNDNEIILDESVYRSEKATGDRNRAIGYLLKSKGVLKGDVL
QTLDLYFKLCSLSVNARSLSELGLLLANGGISTTTGKRLLDKKVVRTLKTLMLTCGMYDR
SGEFAVRVGIPSKSGVGGGILSCVGGRMGIGIYGPALDEKGNSIGGGYTLEYLSEHLNLH
ILDSADAKETQN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggaagttgcgaaagatgcctgggagtatgggcgaaaatttctgctgcaggga
aaagtcgcagattatatccctgagcttgggaaagcaaatccagtacattttggactatgt
attaaaacagaagatggccgtcatatcgaatttggcgattccgaatgccgttttactata
cagagtatctgtaaaattgtttccctcgcagcagcactgcaatacatcggtgaagaaaag
gtctttaagaatgtgatgatggaaccgtccggggatgcgttcaattcaattttaaagctt
gacacagcgagcaaccgcccgttcaatccaatgatcaatgctggggccattgaagttgta
agtcttctggcagggcgtttctctttcgagaagatgctggaatttatccgcaccttatgt
aatgacaatgaaatcattctggatgaatccgtctaccgctccgaaaaagcgaccggcgac
aggaatcgggcgatcggatatctgttaaagagcaagggcgtgttaaagggggatgttctc
cagactctggatctctactttaagctctgttccttaagtgtaaacgccagatcattatcc
gaattaggtcttcttcttgcaaacggaggtatttccaccactaccggaaaacgccttctc
gacaaaaaagtcgtccgaacattaaaaacccttatgctgacctgcggcatgtacgaccgt
tccggggaatttgccgttcgtgtgggaatcccatccaaaagcggtgtcggcggcggaatc
ctgtcctgtgtgggaggccgtatgggaattggaatctatggaccggcacttgacgaaaaa
ggcaacagcatcggcggcggatatacgctggaatatctttctgaacatttgaatcttcac
atccttgattccgctgatgcaaaagaaacacaaaattaa

DBGET integrated database retrieval system