KEGG   Butyrate-producing bacterium SS3/4: CK3_25230Help
Entry
CK3_25230         CDS       T02611                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bprs01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bprs00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2592237..2593082
Genome map
AA seq 281 aa AA seqDB search
MTERELLKDKKRIVIKIGSSSLTHAETGDLNLAKIEKLVRIISDMRGMGKEVILVSSGAI
ATGRQTLGGKKPETVAEKQAYAAVGQARLMMVYQKLFSEYNQTAAQILITKATILDDTSR
TNAKNTFNELLKLGTVPIVNENDTVSTYEIKFGDNDRLSAIVAALVEGDLLFLLSDIDGL
YTDDPKKNPDAKFISQVDDLTDEFMAMGKGTTGSDVGTGGMATKLHAAKIATESGADMVI
ANADDLEVMWRILKGEEIGTLFKANKSSEFALLDYIQSIHA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacagagagagaattattaaaagataaaaagagaatcgtgatcaagatcggatcttct
tcactgacacacgcggagacaggcgatctgaatcttgcaaagatcgagaagcttgtccgc
atcatcagtgacatgagaggcatgggaaaagaagtgatccttgtttcctccggtgccatc
gccacaggacgccagactctcggcggaaagaaaccggagacggttgccgagaaacaggca
tacgcagctgtgggccaggcacgtctcatgatggtgtaccagaagcttttctccgagtac
aaccagactgcggcacagatcctgatcacaaaggcgacgatcctggatgatacctcccgc
acgaacgcgaagaacacgttcaatgaacttttaaagctcggaacggtgccgatcgtaaat
gagaacgataccgtatctacatatgaaattaaattcggtgataacgacagactgtctgcc
atcgttgcagccctcgtggaaggcgacctgctattccttctctccgatatcgacggcctc
tacaccgacgatccgaagaaaaacccggacgcgaagttcatcagccaggtggatgatctt
accgatgaatttatggctatgggtaagggaaccacaggaagtgacgtgggaaccggtgga
atggcgacgaagctccatgcggcaaagatcgcgacggagagcggagccgacatggtgatc
gccaacgcggacgatctggaagttatgtggcggatcttaaagggcgaggagatcggaacg
ctctttaaagcgaataagagcagtgaatttgcgctgttggattatatccagagcattcac
gcgtaa

DBGET integrated database retrieval system