KEGG   Burkholderia pseudomallei K96243: BPSL0043Help
Entry
BPSL0043          CDS       T00203                                 

Definition
type III restriction system endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bps  Burkholderia pseudomallei K96243
Brite
Enzymes [BR:bps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BPSL0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:44222..47251
Genome map
AA seq 1009 aa AA seqDB search
MQLHFESDLDYQLEAIEAVCDLFRGQEACRAEFSVTAQAARRRAGPQISLGMAESGLGVG
NRLTLDAHTFAENLARVQVRNGLPPSGAPSSNDFTVEMETGTGKTYVYLRTIFELHRRFD
FTKFVIVVPSVAIKEGVHKTLQITEQHFRRLYAGVPFDYFVYDSAKLGEVRSFASKSIVQ
IMIVTVAAINKKDVNTLYKDSEHTGGEKPIDLIRATHPIVIVDEPQSVDGGLEGRGKEAL
EAMRPLCTLRYSATHADKYQMLYRLDAIDAYERKLVKQIEIASATVEDAHNKPFVRVISI
GSRRGAIAARVELDVATAAGDVERQTVSVSDGDDLERVARRAVYANFSIGEIHAARGAEY
LVLRYPGGDAFLSVGDAYGDVDTHAIQREMIRRTIREHLDKELRLTPLGVKVLSLFFVDA
VDKYRKYDRHGQPFKGDYALLFEDEYRRAAKLPEYRALFDGVDAGLAAEAVHDGYFSIDK
KGGWTDTSDRSAGSRENAERAYGLIMKDKERLLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIHSERERRQTIGRGLRLAVNQRGERVRGFDVNTLTVIAGESYEQFAENLQKEIEA
DTGIRFGIVETHQFAALPVPADDGSVQPLGVERSAALWMHLRDAGYLDARGRVQDTLRAA
LKLRALPLPDEFDALRALIVDMLRKLAGRLDVRNADERRHIALRRDAHGKAVYLGDAFRA
LWDRIRHRTTYRVNFDNARLIERCVAALKAAPAVTRARLQWRKADIAIDASGVEATETED
AGAIAIDEGEVELPDLLTELQDRTQLTRRTIAKVLIESGRLDEFPLNPQRFIALVAAALE
RCKRDALVDGIEYRLLGEAQVHALSLFESEPLTGYLSSMRRGAAKSIHEDVPCDTPAERA
FVESLEQDDAVRLYAKLPGWFKIPTPLGSYSPDWAVLIAEGDGPRLYFVVESKSGVADGD
LRADERRRVQCGAAHFRALEAVADNPARYVRARRADDLPTAAANARDAA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcatttcgagtcggatctcgactatcagctcgaagcgatcgaggcggtatgc
gatctgtttcgcggccaggaggcgtgccgcgccgaattcagcgtcaccgcgcaggccgcg
cggcggcgcgcgggcccgcagatttcgctcgggatggccgaatcggggctcggcgtcggc
aatcgcctgacgcttgatgcgcacacgttcgccgagaatctcgcgcgcgtgcaggtgcgc
aacggcctgccgccgtccggcgcacccagctcgaacgatttcaccgtcgagatggaaacg
ggcacgggcaagacctacgtgtacctgcgcacgatcttcgagctgcaccgccgcttcgac
ttcacgaagttcgtgatcgtcgtgccgtcggtcgcgatcaaggagggggtgcacaagacg
ctgcagatcaccgagcagcatttccggcgcctttacgcgggcgtgccgttcgactatttc
gtctacgattcggcgaagctcggcgaggtgcgcagcttcgcgtcgaaatcgatcgtgcag
atcatgatcgtcacggtcgcggcgatcaacaagaaggacgtcaacacgctctacaaggac
agcgaacatacgggcggcgagaagccgatcgacctgattcgcgcgacgcacccgatcgtg
atcgtcgacgagccgcagagcgtggacggcgggctcgaggggcgcggcaaggaggcgctc
gaggcgatgcgcccgctctgcacgctgcgctactcggcgacgcacgcggacaagtatcag
atgctgtaccggctcgacgcgatcgacgcttacgagcgcaagctcgtcaagcagatcgag
atcgcgtcggcgaccgtcgaggacgcgcacaacaagccgttcgtgcgcgtgatatcgatc
ggcagccggcgcggcgcgatcgccgcgcgcgtcgagctcgacgtcgcgacggccgcgggc
gatgtcgagcggcagacggtttccgtctccgacggcgacgatctggagcgcgtggcgcgt
cgcgccgtctatgcgaatttttcgatcggcgagattcacgcggcgcgcggcgccgaatat
ctggtgctgcgctatccgggcggcgacgcgttcctgtcggtcggcgacgcatacggcgac
gtcgatacgcacgcgatccagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggagctgcgcctcaccccgctcggcgtgaaggtgctgtcgctcttcttcgtcgacgcg
gtcgacaagtatcgcaagtacgaccgccacggccagccgttcaagggcgactacgcgctg
ctgttcgaagacgaataccggcgcgcggcgaagctgcccgaatatcgcgcgctgttcgac
ggcgtcgacgcgggcctcgcggccgaggcggtgcacgacggctatttctcgatcgacaag
aaaggcggctggaccgacacgagcgaccggagcgccggcagccgggagaatgcggagcgc
gcgtacgggctcatcatgaaggacaaggagcggctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaatccgaacgtgttccagatc
tgcacgctgcgcgacatccacagcgagcgcgagcgccgccagacgatcggccgcgggctg
cgtctcgccgtcaaccagcgcggcgagcgcgtgcgcggtttcgacgtcaatacgctgacg
gtgatcgcgggcgaaagctacgagcagttcgccgagaatctgcaaaaggagatcgaagcc
gatacggggatccgcttcggcatcgtcgagacgcaccagttcgccgcgctgccggtgccg
gccgacgacggcagcgtgcagccgctcggcgtcgaacgctccgccgcgctgtggatgcat
ctgcgcgacgccggctatctcgacgcgcgcggccgcgtgcaggacacgctgcgcgcggcg
ctcaagctgcgcgcgttgccgctgcccgacgagttcgacgcgctgcgcgcgctgatcgtc
gacatgctgcgcaagctggcgggccggctcgacgtgcgcaacgcggacgagcgccgccac
atcgcgctgcggcgcgacgcgcacggcaaggcggtgtacctgggcgacgcattccgcgcg
ctgtgggaccgcatccggcaccgcacgacgtaccgcgtgaacttcgacaacgcgcgcctg
atcgagcgctgcgtcgccgcgctgaaggcggcgcccgccgtcacgcgcgcgcggctgcag
tggcgcaaggccgatatcgcgatcgacgcgtcgggcgtcgaggcgaccgaaaccgaggat
gcgggcgcgatcgcgatcgacgaaggcgaggtcgagctgccggatctgctgaccgagctg
caggaccgcacgcagctcacgcgccgcacgatcgcgaaagtgctgatcgaaagcggccgg
ctcgacgagttcccgctcaatccgcagcgcttcatcgcgctcgtcgccgcggcgctcgag
cgttgcaagcgcgacgcgctcgtcgacgggatcgagtacaggctgctcggcgaagcgcag
gtgcacgcgctttcgctgttcgagagcgagccgctcaccggctatctgtcgagcatgcgg
cgcggcgcggcgaaatcgattcacgaggacgtgccgtgcgacacgcccgccgagcgcgcg
ttcgtcgaatcgctcgaacaggacgacgcggtcaggctgtacgcgaagctgcccggctgg
ttcaagattccgacgccgcttggcagctacagccccgactgggcggtgctgatcgccgaa
ggcgacgggccgcggctctatttcgtcgtcgaatcgaagagcggcgtcgccgacggcgat
ctgcgcgctgacgagcggcgcagggtccagtgcggcgccgcgcatttccgcgcgctggag
gcggtggcggacaaccccgcgcgctacgtgcgcgcgcgccgcgccgacgatctgccgacg
gccgccgccaacgcgcgcgatgcggcctga

DBGET integrated database retrieval system