KEGG   Burkholderia pseudomallei K96243: BPSL0391Help
Entry
BPSL0391          CDS       T00203                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00071  Fatty acid degradation
bps00280  Valine, leucine and isoleucine degradation
bps00281  Geraniol degradation
bps00310  Lysine degradation
bps00360  Phenylalanine metabolism
bps00362  Benzoate degradation
bps00380  Tryptophan metabolism
bps00410  beta-Alanine metabolism
bps00627  Aminobenzoate degradation
bps00640  Propanoate metabolism
bps00650  Butanoate metabolism
bps00903  Limonene and pinene degradation
bps00930  Caprolactam degradation
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01212  Fatty acid metabolism
Module
bps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPSL0391
   00650 Butanoate metabolism
    BPSL0391
  Lipid metabolism
   00071 Fatty acid degradation
    BPSL0391
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPSL0391
   00310 Lysine degradation
    BPSL0391
   00360 Phenylalanine metabolism
    BPSL0391
   00380 Tryptophan metabolism
    BPSL0391
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPSL0391
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPSL0391
   00281 Geraniol degradation
    BPSL0391
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPSL0391
   00627 Aminobenzoate degradation
    BPSL0391
   00930 Caprolactam degradation
    BPSL0391
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPSL0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 3092781
NCBI-ProteinID: YP_107017
UniProt: Q63XZ8
Position
1:424759..425586
Genome map
AA seq 275 aa AA seqDB search
MTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWRDVDRDPD
ARVAVIRGEGKGFSAGGDLALVERMADAHAVRERVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNWLRLAGPTFDA
SLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgctctctatgccggctatgaagcgctgcgcatccagcgccggccgcac
ggcatcgtcgaaatcgtgatgagcggcgaaggcgcgaaccgcagcggcctcgcggtcgcg
agcgaggcgatgcaccgcgagctcgccgatatctggcgcgacgtcgaccgcgatcccgac
gcgcgcgtcgcggtgatccgcggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgagcgcatggccgacgctcacgcggtgcgcgagcgcgtctggcgcgaagcgcgc
gatctcgtctacaacgtgatcaattgcagcaagccgatcgtgtcggcgatgcacgggccg
gccgtcggcgccgggctcgtcgccgggctgctcgccgacgtgtcgatcgccgcgaagcac
gcgcggatcatcgacgggcacacgcgtctcggcgtcgccgcgggcgatcacgcggcgatc
gtctggccgctgctctgcgggatggcgaaggcgaaataccacctgctcctctgcgagccc
gtgagcggcgaggaggccgagcgcatcgggctcgtgtcgctcgcgctcgacgatcacgag
ctgctgccgaaggcgtacgagatcgccgagcgcctcgcgcaaggctcgcaaagcgcgatc
cgctggaccaagtacgcgctcaacaactggctgcggctggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggtttttccgggccggacgtgcgcgaaggcattcgctcg
ctgcgcgagcgccgcgcgccggatttcacgggcggcgcgccgtcttga

DBGET integrated database retrieval system