KEGG   Burkholderia pseudomallei K96243: BPSL0500Help
Entry
BPSL0500          CDS       T00203                                 

Definition
(RefSeq) chitobiase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00511  Other glycan degradation
bps00520  Amino sugar and nucleotide sugar metabolism
bps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BPSL0500
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BPSL0500
Enzymes [BR:bps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BPSL0500
Chaperones and folding catalysts [BR:bps03110]
 Intramolecular chaperones
  Others
   BPSL0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 3094367
NCBI-ProteinID: YP_107125
UniProt: Q63XP0
Position
1:complement(546569..549070)
Genome map
AA seq 833 aa AA seqDB search
MNRVPHSLCAALLAAATLLPTASRAQLPARPTAGAAAPATAAPVRPASTPAELAARLANG
LAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQNRGHSPLTDGGWKLYLHSIRRLL
RIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELPFVAEYWLRRYSDVIPRPYVVVDG
AAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAAAQPVANRALPSVKRQRALPGALD
LRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWGVVAPRRLPADIAVPGGYRLAIGP
RGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIEDAPRFTHRGMHVDLARNFKPPAT
LRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDVGARRCHDPSETRCLLPQLGSG
PDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPAHSRAAVVSMEARYRRLHAAGRER
EANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALNFASKVIREIASMHADAQAPLRIW
HFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKPWARSPACTALLRRGEIKSIDELP
TRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFSTRHVMVSLWDTIFWGASDSARDLS
AKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATDEYKVFSLAPENLPQNAEVFGDRD
GNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMVYPRLLALAERAWHKADWELPYAA
GVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLERAGIGYRKPTFTLTGE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgggtaccgcattccctgtgcgccgcgctattggccgccgcgacgctgttgccc
acggcctcgcgcgcgcaactgcccgcgcgccccacggccggcgcggccgcgcccgcgacg
gccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctcgccaacggc
ctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtgccgtgcgcc
gacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcagaatcgcggc
cactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgccggctgctc
cgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctgtacgagctgacg
ccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccgttcgtcgcc
gaatactggctgcgccgctacagcgacgtgatcccgcgcccgtacgtggtcgtcgacggc
gcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctacgtcgaaacg
ctgcccgccgacgcgcagaacaactcgcccggcaatgcgccgcccgccgccgcgcagccg
gtggcgaaccgcgcgctgccgagcgtgaagcggcagcgcgcgctgcccggcgcgctcgat
ctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcggcgctgcgc
gaacgcgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggcgtcgtcgcg
ccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcgatcggcccg
cgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtgcagacgctc
ttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaagacgcgccg
cgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccgcccgccacg
ctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcatctgcacctg
tccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgaccgacgtcggc
gcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctcggctcgggg
cccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcgctgctgcgc
tacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcgcactcgcgc
gcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggccgcgagcgg
gaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctgaccgtgcag
ttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaacttcgcgtcg
aaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctgcggatctgg
cacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccagccgctcgac
ggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccgtgggcgcgc
tcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgacgaattgccg
acgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggcacgatggcc
gcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacgcggcacgtg
atggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgcgatctgagc
gcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgatttcccgtac
acgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggacgagtacaag
gtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggcgatcgcgac
ggcaacccgttcgaggtgacgagcgcgggcgcggcgccgagcatcgagggcatccagggg
caggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtgtatcctcgc
cttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccctacgcggcc
ggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctcgagcgcgac
tgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgagcgtgcgggc
atcgggtatcgcaagcccacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system