KEGG   Burkholderia pseudomallei K96243: BPSL0687Help
Entry
BPSL0687          CDS       T00203                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bps00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:complement(782878..784380)
Genome map
AA seq 500 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWSTQAGVA
AEAVTRVGLNGTAIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDKLKAQGL
SEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGKLAFGTVDSWLVWNFTKHELHV
TDVTNASRTMLFNIHTLDWDDELLDALEIPRSMLPQVRASSEIYGPTKTTVFASKIPLAG
IAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGETPIESRNNLVTTIAWQVDGKVSYA
LEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVYLVPAFAGLGAPHWNARAR
GSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRIGELRVDGGASANNLLMQF
QADLLGVDAVRPRITETTALGAAYLAGLAIGYWQNVDELHSQWQLERRFAPSMQAEQVGS
CLAGWQRAVRAAKAWADDTQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcagtacatcctcgcgctcgaccagggcacgaccagctcccgcgccatgctg
ttcgatcgacaaggcaacatcgtatcgatcgcgcagaaggaattcgaacaaatttatccg
cagccgggctgggtcgagcacgatccccaggagatctggtcgacgcaggcgggcgtcgcg
gccgaggccgtcacgcgcgtcggcctgaacggcacggcgatcgccgcgatcggcatcacg
aaccagcgcgagacgacgatcgtctgggatcgcgagacgggtcatccgatctacaacgcg
atcgtctggcaggatcgccgcaccgccgatttctgcgacaagctcaaggcgcagggcctc
agcgagaaggtgcgcgcgaagacgggcctgccgatcgactcgtacttctcggccaccaag
atccgctggattctcgacaacgtcgagggcgcgcgcgagaaggcgcgccagggcaagctc
gcgttcggcacggtcgacagctggctcgtgtggaacttcacgaagcacgagctgcacgtg
accgacgtgacgaacgcgtcgcgcacgatgctcttcaacatccacacgctcgactgggac
gacgagttgctcgacgcactcgagattccgcgcagcatgctgccgcaagtgcgcgcgtcc
tccgagatctacgggccgacgaagaccaccgtgttcgcctcgaagattccgctcgccggc
atcgcgggcgatcagcaggccgcgctcttcggccagatgtgcacgagctcgggcatggtg
aagaacacctacggcaccggctgcttcctgatgatgaacaccggcgagacgccgatcgaa
tcgcggaacaacctcgtcacgacgatcgcctggcaagtcgacggcaaggtcagctacgcg
ctcgaaggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgacgggctcggc
atcatcaagagcgcgtcggagatcgaggcgctcgccgccggcgtgccgcacacggacggc
gtctatctcgtgcccgcgttcgccggcctcggcgcgccgcactggaacgcgcgcgcccgc
ggctcgctgttcggcgtcacgcgcggcacgacgtccgcgcacctcgcgcgcgcggcgctc
gattcgatcgcgtatcaatcgctcgacgtgctcaaggccatggaggccgattcgggcatc
cgcatcggcgagctgcgcgtggacggcggcgcgagcgcgaacaacctgctgatgcagttc
caggcggatctgctcggcgtcgacgcggtgcgcccgcgcatcaccgagacgaccgcgctc
ggcgccgcgtatctcgcgggcctcgcgatcggctactggcagaacgtcgacgagctgcac
agccaatggcagctcgagcgccgcttcgcgccttcgatgcaggccgagcaggtgggctct
tgcctcgccggctggcagcgcgcggtgcgcgcggcgaaggcatgggcggacgacacgcag
taa

DBGET integrated database retrieval system