KEGG   Burkholderia pseudomallei K96243: BPSL0966Help
Entry
BPSL0966          CDS       T00203                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BPSL0966
   00240 Pyrimidine metabolism
    BPSL0966
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BPSL0966
   03430 Mismatch repair
    BPSL0966
   03440 Homologous recombination
    BPSL0966
Enzymes [BR:bps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BPSL0966
DNA replication proteins [BR:bps03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BPSL0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:1124687..1125103
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHTNVGDSLAYACRLLRKAYQAGQPVVVCAEPARLRALDERLWTFSPLDFIPHCA
IDNAHAASTPIVLTADLERAPHHGILLNLGAQVPAQFARFERLLEVVGNAPDELAAGRDR
YRFYRDRGYALNNHKQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatttccatacgaatgtcggcgattcgctcgcgtacgcgtgccggctg
ctgcgcaaggcgtatcaggcggggcagcccgtcgtcgtgtgcgcggagcccgcgcggctg
cgcgcgctcgacgagcgtctgtggacgttctcgccgctcgatttcattccgcattgcgcg
atcgacaacgcgcacgcggcgagcacgccgatcgtgctgaccgcggatctcgagcgcgcg
ccgcatcacgggatcctgctgaacctgggcgcgcaggtgccggcgcagttcgcacgcttc
gagcgcctgctcgaggtggtcggcaacgcgcccgacgagctcgcggccggccgcgaccgg
tatcggttctatcgcgatcgcggctacgcgctcaacaatcacaagcagggcggctag

  All links  
No link information was found.   
DBGET integrated database retrieval system