KEGG   Burkholderia pseudomallei K96243: BPSL1209Help
Entry
BPSL1209          CDS       T00203                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPSL1209 (tpiA)
   01230 Biosynthesis of amino acids
    BPSL1209 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSL1209 (tpiA)
   00051 Fructose and mannose metabolism
    BPSL1209 (tpiA)
   00562 Inositol phosphate metabolism
    BPSL1209 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BPSL1209 (tpiA)
Enzymes [BR:bps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BPSL1209 (tpiA)
Exosome [BR:bps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BPSL1209 (tpiA)
  Exosomal proteins of bladder cancer cells
   BPSL1209 (tpiA)
  Exosomal proteins of melanoma cells
   BPSL1209 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:1395230..1395985
Genome map
AA seq 251 aa AA seqDB search
MSKQRIKRVIGNWKMHGRLSGNEALLDEVAQGAQAVPEHVGIGVCVPFPYLAQARARLHG
GRVAWGAQDVSAHEQGAFTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNEIVAAKAQRA
LAAGLTPVVCVGETLAEREAGATEQVVGVQLAAVLAVLSQDEAARIVVAYEPVWAIGTGR
SATAEQAQQVHAFLRGRLAAKGAERVSLLYGGSVKADNAAELFSQPDIDGGLIGGASLKS
GDFLAICRAAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaaagaatcaagcgggtgatcggcaactggaagatgcacggtcgcctgagc
ggcaacgaggcgctgctcgacgaagtcgcgcagggcgcgcaagccgtgcccgagcacgtc
ggcatcggcgtgtgcgtgccgtttccgtatctcgcgcaggcgcgggcccggcttcacggc
ggtcgcgtcgcgtggggcgcgcaggacgtatccgcgcacgagcagggcgcctttaccggc
gaagtcgcggccggcatggtcgcggagttcggcgcggcgtacgcgatcgtcgggcactcg
gagcgccgcgcgtatcacggcgaatcgaacgagatcgtcgcggcgaaggcgcaacgtgcg
ctcgccgcggggctgacgcccgtcgtgtgcgtcggcgagacgctcgccgagcgcgaagcg
ggcgcgaccgagcaggtcgtcggcgtgcagctcgccgcggtgctcgcggtgctgtcgcag
gacgaggcggcgcgcatcgtcgtcgcgtacgagcccgtatgggcgatcggcacgggccgc
agcgcgacggcggagcaggcgcagcaggtgcacgcgttcctgcgcgggcggctcgcggcg
aagggcgccgagcgcgtgtcgctgctgtatggcggcagcgtgaaggccgacaacgcggcc
gagctgttcagccagcctgacatcgacggcggcctgatcggcggcgcgtcgttgaagagc
ggggatttcctggcgatttgccgggcggcgcagtaa

DBGET integrated database retrieval system