KEGG   Burkholderia pseudomallei K96243: BPSL1284Help
Entry
BPSL1284          CDS       T00203                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPSL1284
Enzymes [BR:bps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BPSL1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:1494163..1496859
Genome map
AA seq 898 aa AA seqDB search
MSVVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAA
SRATAAGHVCVALRALAQRYDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYL
ARYFEYETRLANALVERSRCGGAPACGADALSPDALGERLVRYFGPQKERGVDWQRVAAL
IALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPELRIALAAPTGKAAQRMQEALHARAG
SLPAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLD
ALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARALGVGEAEFVAALPD
GFVVQAVGAERVADARAAAADMDVAARGTAGAAAAAARATAAAAARMTTAAAAARGGAPE
SAAQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFGVGTSCGEPGAGAQGAGRRDG
GAPSLDEPHAGRRDGGASPGVAHSRRDAFDARARSGPADVSDLENAARAYAPAGAAGPAD
SPADASFVEPAAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDAGARTAPPV
AREATAPTPRETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDA
LSTQDDAAARFSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFR
VLCATRTGARGAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIG
IALPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALILPASFN
RVLSRELVYTAITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgag
ccggccgatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcg
cggcgtgtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcg
agccgcgcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgctac
gacgagccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgac
ggcatcgtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctc
gcgcgctacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgc
ggcggcgcgccggcgtgcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctc
gtccgctatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggcgctc
atcgcgctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacg
acggtcgtcggcgtgatcgcgtgcctgctcgatgcgcatccggagttgcggatcgcgctt
gccgcgcccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggc
agcctgccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctg
ctgggcggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgat
ctcgtcgtcgtcgacgaggcttcgatgatcgacgtcgcgctcgctgcgcatttgctcgac
gcgctcgcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtc
gaggcgggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgc
gcgacgatcgcgcgcgcgctcggcgtcggcgaggccgagttcgtggcggcgctgccggac
gggttcgtcgtgcaggcggtcggcgcggagcgcgtggcggacgcgcgtgcggcggcggcc
gatatggacgtggccgcgcgcgggacggccggcgccgcggctgcggccgcacgagcgacc
gcggccgcagccgcacgaatgaccacggccgcagccgcggcgagggggggcgcgccggaa
tccgccgcgcaacgcgcgccggcgccgcacgcgggccggcgcggcggcgggcgcgcatcg
aatcggaccgtcgacgatgcgcagggatcgttgttcgcgttcgacgacgacgcattcggt
gtgggcacgtcgtgcggcgagccgggggccggcgcgcaaggtgccgggaggcgagatggc
ggggcgccgagcctcgacgagccgcacgccgggcgccgggacggcggcgcatcgcccggc
gtcgcgcacagccggcgcgatgcgttcgacgcgcgtgcccggtcgggtccggcggatgtt
tccgacctggaaaacgccgcgcgcgcgtacgcgccggcgggcgcagccggcccggccgat
tcgccggcggacgcgtctttcgtcgagccggccgcgtggatcgaagcggacgaactcgcg
tggctcgacaacgcggtcttttcgttctccgaaggcgcttcggcgaatgccgaagccgac
gggcggcgaagcgccgcggcgacggcgaccgacgcgggcgcgcgcaccgcgccgccggtt
gcgcgggaagcgacggcgccgacgccgcgcgagaccgcgcgatcggacggttccgccgtc
gcgccgctgaccgactgcgtcgtctggcttgaacgcaactatcgcttcggccttgattcg
ccgatcggccggctgtcgcttgcgattcgccgcggcgcggtgcaggacgcgctcgacgcg
ctatcgacgcaagacgacgcggccgcgcgttttagcgacgacggcggtgcgacgctatcg
gccgcgacggtcgagcagctcgcgcgaggcttcgccggctatgcggccgcgctgcgcgac
gcgctggcgacgcccgagcccgatgcgctgccgctcttcgacgtgctcaaccgctttcgc
gtgctttgcgcgacgcgcacgggcgcgcgcggcgcggaggaagtcaacgcgcgcatggcg
gccgaggtgcgccgcgcggtgcgcgtgccgctcgcgctcggtgcgcactggttcgccgga
cggcccgtgatggtgacgcgcaacgattacgcgctcggcctcttcaacggcgacatcggc
attgcgctgcccggcgcgcgcggtgcgctgcgcgtctggtttcgcggcgcggacggccgc
gcccgggcggtgtcgcccgccgcgctgccgccgcacgacacggcgttcgcgctgaccgtc
cacaaatcgcagggctcggaattcgacgacgcggcactgatcctgcccgcgtcgttcaat
cgcgtgctgtcgcgcgaactcgtctacaccgcgatcacgcgcgcgcgcgcgcgcgtgcag
gtgatcggctcgcgcgcggtgctcgcgctcgcgatcgcgacgcgcacggcgcgcgattcc
ggccttgccgcacgaatcgccgatgcgctgcgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system