KEGG   Burkholderia pseudomallei K96243: BPSL1357Help
Entry
BPSL1357          CDS       T00203                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:1585195..1586085
Genome map
AA seq 296 aa AA seqDB search
MSSSDSVFPVPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRYVARDAALAQAERMLA
EGADILDIGGESTRPGAPPVPLNEELERVIPLVEALRGRNVPLSIDTYKPAVMRASLAAG
ADLINDIWGLRQPGAIDAVRDSACGLCVMHMLGEPRTMQVHAPEYRDVIDDVRAFLAERA
DALVQAGIDARRISVDPGFGFGKSVIEHNYALLAHLPRTAPARPDGRAYPILAGMSRKSM
LGAVIGRPAPERIAASVAAAVCAAERGAAIVRVHDVAATVDALKVWSAVRDAARRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagttccgattccgtttttcccgttcccgcgccgctgcaatgcggccgtttcacc
ttgaccttcgagcgccccctcgtgatggggatcctcaacgtcacccccgattcgttctcc
gacggcggccgttacgtcgcccgtgacgccgcgctcgcgcaggcggagcggatgcttgcc
gaaggcgcggacatcctcgacatcggcggcgaatcgacgcgccccggcgcgccgcccgtg
ccgcttaacgaggagctcgagcgcgtgattccgctcgtcgaggcgctgcgcggccggaac
gtgccgctgtcgatcgacacgtacaagcccgccgtgatgcgcgcgtcgctcgccgcgggc
gccgatctgatcaacgatatctgggggctgcggcagccgggcgcgatcgacgcggtgcgc
gacagtgcgtgcggcctctgcgtgatgcacatgctcggcgagccgcggacgatgcaggtg
catgcgcccgagtatcgcgacgtgatcgacgacgtgcgcgcgtttctcgccgagcgcgcc
gatgcgctcgtgcaggcgggcatcgatgcccgacgtatcagcgtcgatccggggttcggt
ttcggcaagtcggtgatagaacacaactatgcgctgcttgcgcatttgccgaggaccgcg
cccgcgcggcccgacgggcgcgcgtatccgatcctcgccggcatgtcgcgcaagtcgatg
ctgggcgcggtgatcggcagacccgcgccggagcgcatcgcggcgagcgtcgcggcggcg
gtctgcgcggccgagcggggggcggcgatcgtgcgcgtgcacgacgtcgcggcgaccgtc
gacgcattgaaagtatggagcgccgtgcgcgatgccgcgcggcgagcataa

DBGET integrated database retrieval system