KEGG   Burkholderia pseudomallei K96243: BPSL1411Help
Entry
BPSL1411          CDS       T00203                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BPSL1411
Enzymes [BR:bps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BPSL1411
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BPSL1411
Lipid biosynthesis proteins [BR:bps01004]
 Fatty acid synthase
  Component type
   BPSL1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:complement(1643189..1643863)
Genome map
AA seq 224 aa AA seqDB search
MKRTVHWKAVATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRDTG
WVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALRGV
PLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFRGVYTGLSKEMRVPLVPF
LLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacagttcactggaaggccgtcgcgacgctcgccgtggtcgcgacgttcgcc
ggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggcaagccg
gtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgatacgggc
tgggtcgcgctgatgcgcgcgcgcctcgcggccgagcgaatcgattatagcgtcgcgaac
gcgagcatctccggcgacacgacgagcggcggccgcgcgcggctgcccgcggtgctcgca
cggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgcggcgtg
ccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcaggcgcgc
gcgcaggtgctgctcgtcggcatgtacgtgccgtcgaactacggcccggactacacgcaa
aagttccgcggcgtctacacggggctgtccaaggagatgcgcgtgccgctcgtgccgttc
ctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccatccgacg
caggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctgctgcgg
acgtcatcgcgctga

DBGET integrated database retrieval system