KEGG   Burkholderia pseudomallei K96243: BPSL1425Help
Entry
BPSL1425          CDS       T00203                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BPSL1425
Enzymes [BR:bps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BPSL1425
    3.5.1.-  
     BPSL1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:1662505..1663143
Genome map
AA seq 212 aa AA seqDB search
MQRTDDVLLVIDVQNDFMPGGALAVAHGDEVVPAINRLAARFDHVVLTQDWHPRDHVSFA
ANHPGRAPFSTLALPYGEQVLWPVHCVQGTHGAALHGDLDIPHARLVVRKGHRASVDSYS
AFVEADRRTPTGLAGYLREIGAKRVWCCGLATDYCVAWSALDARAAGFDAAVIEDACRAI
DLDGSLARAWASLAAAGVARVQSAEVCPGVDP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaccgacgatgtccttctcgtgatcgacgtgcagaacgatttcatgccgggc
ggcgcgctcgcggtcgcgcacggcgacgaagtcgtgccggcgatcaaccggctcgccgcg
cgcttcgatcacgtcgtgctgacgcaggattggcatccgcgcgatcacgtgtcgttcgcg
gcgaaccatccgggccgcgcgccgttctcgacgctcgcgctgccgtacggcgagcaggtg
ctgtggcccgtccactgcgtgcagggcacgcacggcgcggcgctgcacggcgatctcgac
atcccgcacgcgcggctcgtggtccgcaaggggcatcgcgcgtcggtcgacagctactcg
gcgttcgtcgaggccgaccgccgcacgccgaccgggcttgccggctatctgcgcgaaatc
ggcgccaagcgcgtgtggtgctgcgggctcgcgaccgactattgcgtcgcgtggtccgcg
ctcgatgcgcgcgccgcgggcttcgacgcggccgtgatcgaggacgcgtgccgcgcgatc
gatctcgacggctcgctcgcgcgcgcatgggcgtcgctcgccgcggcgggcgtcgcgcgc
gtgcagtcggccgaggtttgcccgggcgtcgatccgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system