KEGG   Burkholderia pseudomallei K96243: BPSL1500Help
Entry
BPSL1500          CDS       T00203                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPSL1500 (recR)
DNA repair and recombination proteins [BR:bps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BPSL1500 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:1738571..1739179
Genome map
AA seq 202 aa AA seqDB search
MRMSIKPPSALSELVEALRALPGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRH
CEKCNTFTEAQVCEVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDG
IGPKEIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPV
GGELEYVDAGTIARAMLDRRTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcatgagcatcaagccgccgtccgcgctgtccgagctcgtcgaggcgctgcgcgcg
ctgccgggcgtcgggccgaaatccgcgcaacgcatcgcgtaccacctgatgcagcacgat
cgggagggcgccgagcggctcggccggtcgctgctgttcgcgaccgagcacctgcggcat
tgcgagaagtgcaacacgttcacggaggcgcaagtctgcgaggtgtgcagcgatccggag
cgcgatccggcgctgctgtgcgtcgtcgagacgcccgccgatcagatcatgctcgagcag
acgatgacctatcgcgggctgtacttcgtgctgatggggcgcctgagcccgctcgacggc
atcgggccgaaggaaatccatttcgaccggctcgtgcgccgcgcgtccgacggcatcgtg
aaggaggtcgtgctcgcgacgaacttcacgaacgagggcgaggcgaccgcgcactacctc
ggccagacgttgaaggcgcgcggcctggccgtcacgcggctcgcgcgtggcgtaccggtg
ggcggcgagctcgaatacgtcgatgcgggcacgatcgcgcgcgcgatgctcgaccggcgc
acgctttag

DBGET integrated database retrieval system