KEGG   Burkholderia pseudomallei K96243: BPSL1503Help
Entry
BPSL1503          CDS       T00203                                 

Definition
(RefSeq) L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bps  Burkholderia pseudomallei K96243
Brite
Enzymes [BR:bps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BPSL1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_11 NodS Methyltransf_31 RrnaAD Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 3092558
NCBI-ProteinID: YP_108123
UniProt: Q63UU3
Position
1:1741317..1742285
Genome map
AA seq 322 aa AA seqDB search
MSGERAKRFPLALEDLKREPRKPEGRVAERQAAGDAARQRLTAAAAVPAAASPIVPERRA
PHGGVFAAKPARAKQHAPAAPGAAKRAPQGGAKQGDRSAAPNVALSGALALTSERVRERM
VERLRANGVADPRVLAAMSAVPRHMFVDPGLAAQAYEDAALPIGHQQTISKPSVVARMIE
LAAAGRALERVLEIGTGCGYQAAVLSRVARDVYSIERVKPLYERAKLNLRPLRVPNIRLH
YGDGRVGLPAAAPFDAIVIAAAGLDVPRALLEQLAIGGRLVAPVGEQAGEQVLTLVERVA
PAQWRESRLDRVFFVPLKSGVI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggtttccgctcgcgctcgaggatctgaagcgcgagccg
cgcaagcccgagggccgcgtggcggagcgccaggcggcgggagacgccgcccgccagcgc
ctcaccgcggccgccgccgtgcccgccgctgcttctccgatcgtgcccgaacgccgcgcg
ccgcacggcggcgtgttcgccgcgaaacccgcgcgtgcgaagcagcacgcgcctgcggcg
cccggcgccgcgaagcgcgcgccgcaggggggcgcgaagcagggggaccggagcgccgcg
ccgaacgtcgcgctgagcggcgcgctcgcgctgacttcggaacgggtgcgcgagcgcatg
gtcgaacggctgcgggcaaacggcgtggccgatccgcgcgtgctcgccgcgatgtcggcc
gtgccgcgccacatgttcgtcgatcccgggctcgcggctcaggcgtacgaggacgccgcg
ctgccgatcggccatcagcagacgatctcgaagccgtcggtcgtcgcgcgcatgatcgag
ctcgcggcggcgggccgcgcgctcgagcgcgtgctcgaaatcggcacgggctgcggctat
caggccgcggtgttgagccgcgtcgcgcgcgacgtgtattcgatcgagcgcgtgaagccg
ctctacgagcgcgcaaaactgaatttgcggccgctgcgcgtgccgaacatccgcctgcac
tacggcgacggacgcgtgggcctgcccgccgcggcgccgttcgacgcgatcgtgatcgcg
gcggcggggctcgacgtgccgcgggcgctgttggaacaattggcgatcggcggcaggctc
gtcgcgcctgtcggagagcaggcgggcgagcaggtgctgacgctcgtggagcgcgtcgca
cccgcgcagtggcgcgagtcgcggcttgatcgcgttttctttgtccctttaaaatccgga
gtgatttga

DBGET integrated database retrieval system