KEGG   Burkholderia pseudomallei K96243: BPSL1503Help
Entry
BPSL1503          CDS       T00203                                 

Definition
L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bps  Burkholderia pseudomallei K96243
Brite
Enzymes [BR:bps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BPSL1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:1741317..1742285
Genome map
AA seq 322 aa AA seqDB search
MSGERAKRFPLALEDLKREPRKPEGRVAERQAAGDAARQRLTAAAAVPAAASPIVPERRA
PHGGVFAAKPARAKQHAPAAPGAAKRAPQGGAKQGDRSAAPNVALSGALALTSERVRERM
VERLRANGVADPRVLAAMSAVPRHMFVDPGLAAQAYEDAALPIGHQQTISKPSVVARMIE
LAAAGRALERVLEIGTGCGYQAAVLSRVARDVYSIERVKPLYERAKLNLRPLRVPNIRLH
YGDGRVGLPAAAPFDAIVIAAAGLDVPRALLEQLAIGGRLVAPVGEQAGEQVLTLVERVA
PAQWRESRLDRVFFVPLKSGVI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggtttccgctcgcgctcgaggatctgaagcgcgagccg
cgcaagcccgagggccgcgtggcggagcgccaggcggcgggagacgccgcccgccagcgc
ctcaccgcggccgccgccgtgcccgccgctgcttctccgatcgtgcccgaacgccgcgcg
ccgcacggcggcgtgttcgccgcgaaacccgcgcgtgcgaagcagcacgcgcctgcggcg
cccggcgccgcgaagcgcgcgccgcaggggggcgcgaagcagggggaccggagcgccgcg
ccgaacgtcgcgctgagcggcgcgctcgcgctgacttcggaacgggtgcgcgagcgcatg
gtcgaacggctgcgggcaaacggcgtggccgatccgcgcgtgctcgccgcgatgtcggcc
gtgccgcgccacatgttcgtcgatcccgggctcgcggctcaggcgtacgaggacgccgcg
ctgccgatcggccatcagcagacgatctcgaagccgtcggtcgtcgcgcgcatgatcgag
ctcgcggcggcgggccgcgcgctcgagcgcgtgctcgaaatcggcacgggctgcggctat
caggccgcggtgttgagccgcgtcgcgcgcgacgtgtattcgatcgagcgcgtgaagccg
ctctacgagcgcgcaaaactgaatttgcggccgctgcgcgtgccgaacatccgcctgcac
tacggcgacggacgcgtgggcctgcccgccgcggcgccgttcgacgcgatcgtgatcgcg
gcggcggggctcgacgtgccgcgggcgctgttggaacaattggcgatcggcggcaggctc
gtcgcgcctgtcggagagcaggcgggcgagcaggtgctgacgctcgtggagcgcgtcgca
cccgcgcagtggcgcgagtcgcggcttgatcgcgttttctttgtccctttaaaatccgga
gtgatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system