KEGG   Burkholderia pseudomallei K96243: BPSL1767Help
Entry
BPSL1767          CDS       T00203                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bps00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:complement(2082153..2083379)
Genome map
AA seq 408 aa AA seqDB search
MPAAYPFSALIGQAALQQALLLVAVDPGLGGVLVSGPRGTAKSTAARALAELLPEGRFVT
LPLSASDEQVTGSLDLASALADNTVRFSPGLVARAHLGVLYVDEINLLPDALVDALLDAA
ASGVNTVERDGVSHSHAARFALVGTMNPEEGELRPQLLDRFGLMVELANCYDAATRQRIV
KARLAFDLDPHGFRAQYRDAQAALVAQIRAARAALPALAFDDAAHARVAELCIGAAVDGL
RGDLVMLRAARALAALDGAARVAAAHVERVAADVLRHRRTRFEPQPEFQPGFQPGSQAGP
QPMGRREPPPASRSAGGDAPGGRADPGEAEATRAPTPRDALPGGASGPAHPAARAPSDAQ
RRAADERGAARDGGRGPAADDSDWGYLPPEPAGIAPVKGVIPLPLKKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
ttgccggccgcctatccgttttccgcgctgatcggccaggcggcgttgcagcaggcgctg
ctgctcgtcgccgtcgatccgggcctgggcggcgtgctcgtgagcggtccgcgcggcacc
gcgaaatcgaccgccgcgcgcgcgctcgccgagctgctgcccgaggggcgcttcgtcacg
ctgccgctgtcggccagcgacgagcaggtgacgggttcgctcgacctcgcgagcgcgctc
gccgacaatacggtgcgcttttcgcccggcctcgtcgcgcgcgcgcatctcggcgtgctg
tacgtcgacgagatcaacctgctgccggacgcgctcgtcgacgcgttgctcgacgcggcc
gcgagcggcgtcaacacggtcgagcgcgacggcgtgtcgcacagccacgcggcgcgcttc
gcgctcgtcggcacgatgaacccggaagagggcgagttgcgcccgcaactgctcgaccgt
ttcgggctgatggtggagctcgcgaactgctacgacgcggcgacgcggcagcggatcgtc
aaggcgcggctcgcgttcgatctcgatccgcacggctttcgcgcgcagtaccgcgacgcg
caggcggcgctcgtcgcgcaaattcgcgcggcgcgcgccgcgctgccggcgctcgcgttc
gacgacgccgcgcacgcgcgcgtcgccgagctgtgcatcggcgcggccgtcgacggcctg
cgcggcgacctcgtgatgctgcgcgccgcgcgggcgctcgcggcgctcgacggggcggcg
cgcgtcgccgcggcgcacgtcgagcgcgtcgccgccgatgtgctgcgccatcggcgcacg
cggttcgagccgcaacctgaatttcagcccggatttcaacccgggtctcaagccgggcct
cagccgatggggcgacgcgagcctccgcccgcatcgcgttcggccggcggcgacgcgccg
ggcgggcgcgcggatccgggcgaagccgaagccacgcgcgcgcccacgcctcgcgacgcg
ctgcccggcggcgcgagcggaccggcgcatcccgctgcgcgcgcgccgtccgacgcgcag
cggcgcgcggcggacgagcgcggcgcggcgcgcgacggcggccgtgggccggccgccgac
gatagcgactggggctatctgccgcccgagccggcgggcatcgcgcccgtcaagggcgtg
atcccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system