KEGG   Burkholderia pseudomallei K96243: BPSL2079Help
Entry
BPSL2079          CDS       T00203                                 

Definition
glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPSL2079
Enzymes [BR:bps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BPSL2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:2495578..2497800
Genome map
AA seq 740 aa AA seqDB search
MTADPRHPSIVELADAAGLDAHWIDASGFARRVGDDMLAALLDALGYPCDTRAARAESAA
RLAAHAQAAPRLVTGDVDAPLTLPASLGRPGACYRVTLENGDAVAGRFAQPAGAAVLPPL
ATPGYHVLDTGEQRATLAIAPPSAWTPADAMRAAAAGGRERPPPWGLAAQLYGLRREADG
GIGDFTALAACARAAARRGAHALAISPTQAAFPALPEHDSPYSPSSRLWRNAAYIDVETV
LGAHAARAAIADAGLAAQWSALTRAPLVDWPGAVPAKLRVLRLLFDRWRAQAPTGADAGP
RAFARFRARHAGALDAHATFDALQACCIDNGIGADWRRWPPAWRTPDAPDVAAFARAHAH
DIAFYAFLQWQAARGLAAAQRAARGRGMAIGLIADLPVGCDAAGSDAWRDGDAMLRGLSI
GAPADPFNARGQAWGVTTWTPTALRARGFAPFVECLRAGFAHAGGVRIDHVLGLARLWVV
RDGAPPRDGAYLRYPRDDLLRLAALESFRHRAIVIGEDLGTVPADFRARIAARGIVGLRA
LWFERDPAGAFRAPGDWDRHAAATSSTHDLPTVAGWWRGVDLGWRRRAAASASACAPASP
LSPASDAEAEANAPPARPGESEVAGPDALPPEVRDMRRAERAALWRALQQAGVAARGQKM
PPRDAPPVGAILAYVAQAPAPLAIFPLEDLLALEGQPNVPGPPCGHPNWRRRMPRSVDAL
FDAPARTRIAAVRRARKRAR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgatccgcgtcatccgtcgatcgtcgagctcgcggacgcggccgggctcgac
gcgcactggatcgacgcatcgggcttcgcgcggcgggtcggcgacgacatgctcgcggcg
ttgctcgacgcgctcggctacccgtgcgacacgcgcgcggcgcgcgccgagagcgccgcg
cggctcgcggcgcacgcgcaggccgcgccgcggctcgtgacgggcgacgtcgacgcgccg
ctcacgctgcccgcctcgctcggacgccccggcgcgtgctaccgggtcaccctcgaaaac
ggcgacgccgtcgccggccgcttcgcgcagcccgccggcgcagccgtgctgccgccgctc
gcgacgcccggctaccacgtgctcgacaccggcgagcagcgcgcaacactcgccatcgcg
ccgccatccgcatggacgcccgccgacgcgatgcgcgccgcggcggccggcggccgcgaa
cgcccgccgccgtggggcctcgcggcgcaactctacgggctgcgccgcgaggccgacggc
ggcatcggcgatttcaccgcgcttgccgcctgcgcgcgcgccgccgcccggcgcggcgcg
cacgcgctcgcgatcagcccgacgcaggcggccttccccgcgctgcccgagcatgacagc
ccgtactcgccttcgtcgcggctttggcgcaacgccgcctacatcgacgtcgaaacggtg
ctcggcgcgcacgcggcgcgcgcggcgatcgccgatgcggggctcgccgcgcaatggagc
gcgctcacgcgcgcgccgctcgtcgattggcccggcgcggtgccggcgaagctgcgcgtg
ctgcgcctgctgttcgaccgctggcgcgcgcaggcgcccacgggcgcggatgcgggcccg
cgggcgttcgcgcgctttcgggcacggcacgccggcgcgctcgacgcacatgcgacgttc
gacgcgttgcaggcgtgctgcatcgacaacggcatcggcgcggactggcggcgttggccg
cccgcatggcgcacgcccgatgcgccggacgtcgccgcgttcgcgcgcgcgcacgcgcac
gacatcgcgttctatgccttcctgcaatggcaggccgcgcgcgggctcgcggccgcgcaa
cgcgccgcgcgcggccgcggcatggcgatcggcctgatcgcggacttgccggtcggctgc
gacgcggcgggcagcgacgcgtggcgggatggcgatgcgatgctgcgcggcctgtcgatc
ggcgcgcccgccgatccgttcaacgcgcgcggccaggcatggggcgtcaccacgtggacg
ccgacggcgctgcgcgcgcggggcttcgcgccgttcgtcgaatgtctgcgcgcgggcttc
gcgcacgcgggaggcgttcgcatcgatcacgtgctcggcctcgcgcggctgtgggtggtg
cgcgacggcgcgccgccgcgcgacggcgcgtacctgcgctatccgcgcgacgatttgctg
cggctcgccgcgctcgaatcgttccggcatcgcgcgatcgtcatcggcgaggatctcggc
accgtgccggcggatttccgcgcgcggatcgccgcgcgcggcatcgtcggcctgcgcgcg
ctctggttcgaacgggacccggcgggcgcgttccgcgcgccgggggattgggatcgtcac
gcggccgcaacgagctcgacgcacgatctgccgacggtcgcgggctggtggcgcggcgtc
gatctcggctggcgacggcgcgcggccgcctccgcctcggcctgcgcgcccgcgtccccc
ctctctcccgcctccgacgccgaggccgaggcgaacgccccgcccgcgcggcccggcgaa
tcggaggtcgccgggccggatgcgctgccgcccgaggtgcgcgacatgcgccgcgccgag
cgcgcggcgctctggcgcgcgctgcagcaagccggcgtcgccgcgcgcgggcaaaagatg
ccgccgcgggatgcgccccccgtcggtgcgatactcgcgtacgtcgcgcaagcgcccgcg
ccgctcgcgatctttccgctcgaggatctgctcgcgctcgagggtcagccgaacgtgccg
ggcccgccgtgcgggcacccgaactggcggcggcgcatgccgcgctccgtcgacgcgctg
ttcgacgcgccggcgcgcacgcgcatcgccgccgtgcggcgcgcgaggaagcgcgcgcga
tga

DBGET integrated database retrieval system