KEGG   Burkholderia pseudomallei K96243: BPSL2171Help
Entry
BPSL2171          CDS       T00203                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bps01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bps00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:2608004..2609155
Genome map
AA seq 383 aa AA seqDB search
MVRNMSATLALTEQLIARASVTPDDQHCQQLMIERLAALGFECETIASHGVTNFWAVKRG
TAGRAGKLLAFAGHTDVVPTGPLEQWSSPPFVPTHRDGKLYGRGAADMKTSLAGFVVAAE
EFVAAHPQHRGSIGFLITSDEEGPATDGTVKVVEALAARGERLDYCIVGEPTSTATLGDV
VKNGRRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQ
VSNLRAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDRHGLDYTLNWSVSGLP
FLTPRGELSNALDAAIRAETGVSPELSTTGGTSDGRFIARICPQVIEFGPPNASIHKIDE
HIDVRFVDPLKNVYRRVLEQLIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgaaacatgtccgccacccttgccctcaccgaacagttgatcgcgcgcgcgtcc
gtcacgcccgacgatcagcactgccagcaattgatgatcgagcgcctcgccgccctcggc
ttcgagtgcgaaacgatcgcgtcgcacggcgtgacgaacttctgggccgtcaagcgcggc
acggccggccgcgcaggcaagctgctcgcgttcgcgggccataccgacgtcgtgccgacc
ggcccgctcgagcagtggagctcgccgccgttcgtgccgacgcaccgcgacggcaagctg
tacggccgcggcgcggccgacatgaaaacctcgctcgcgggcttcgtcgtcgcggccgag
gagttcgtcgccgcgcatccgcagcaccgcggctcgatcggtttcctgatcacgagcgac
gaggaaggcccggccaccgacggcaccgtgaaagtcgtcgaggcgctcgccgcgcgcggc
gagcgcctcgattactgcatcgtcggcgaaccgacctcgacggcgacgctcggcgacgtc
gtgaagaacggccgccgcggctcgatgtcgggcgagctcgtcgtcaagggcgtgcaaggc
catatcgcgtatccgcatctcgcgaagaacccgatccatctgctcgcgccggcgctcgcc
gagctcgccgccgagcaatgggacgaaggcaacgagtactttccgccgaccacctggcag
gtgtcgaacctgcgcgcgggcaccggcgcgacgaacgtgattccgggccacgccgatctg
ctgttcaacttccgcttctcgacggcgagcacggtcgagggcctgcaggcgcgcgtgcac
gcgatcctcgacaggcacgggctcgattacacgctgaactggtcggtgagcggcctgccg
ttcctcacgccgcgcggcgagctgtcgaacgcgctcgacgccgcgatccgcgcggaaacg
ggcgtctcgcccgagctgtcgacgacgggcggcacgtccgacggccgcttcatcgcgcgc
atctgcccgcaggtgatcgagttcggcccgccgaacgcgagcatccacaagatcgacgag
cacatcgacgtgcgcttcgtcgacccgctgaagaacgtgtaccgccgcgtgctcgaacaa
ctgatcgcctga

DBGET integrated database retrieval system