KEGG   Burkholderia pseudomallei K96243: BPSL2175Help
Entry
BPSL2175          CDS       T00203                                 

Gene name
gpo
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00480  Glutathione metabolism
bps00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BPSL2175 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BPSL2175 (gpo)
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BPSL2175 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 3094481
NCBI-ProteinID: YP_108770
UniProt: Q63SZ6
Position
1:complement(2611872..2612351)
Genome map
AA seq 159 aa AA seqDB search
MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVL
GFPCNQFGKQEPGDASQIGAFCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGL
KAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgtattcattcaacgcgcaggcgctttcggggggcgaggtgccgctcgag
caataccggggcaaggtgctcctcatcgtcaacacggcgagcgagtgcggattcacgccg
cagtacgcggggctgcagcaactgtacgatcgctttcgcgaacgcgggcttgtcgtgctc
ggctttccgtgcaatcagttcggcaagcaggagccgggcgatgcgtcgcagatcggcgcg
ttctgcgagaagaattacggcgtcacgttcccgatgttcgggaagatcgatgtgaacggc
gcgaacgcgcacccgctataccggtatctgaccgaggaggcgcccggcattctcggcctg
aaggcgatcaagtggaatttcacgaagttcctcgtgaaccgggaaggcgagatcgtgaag
cgctatgcgccgtcgacgaagcccgaggatatcgccgcggacgtcgaaaagctgctttga

DBGET integrated database retrieval system