KEGG   Burkholderia pseudomallei K96243: BPSL2192Help
Entry
BPSL2192          CDS       T00203                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bps01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bps00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bps00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:2630844..2632436
Genome map
AA seq 530 aa AA seqDB search
MTTTLKLPQGMAITGEIKPGYEAILTPEALELVAKLHRQFELRRRELLAARVERTQRLDA
GERPDFLAETKSIREGDWKIAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGVFDFALFLFHNAQELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEALGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRAKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDRAMAGVRADKARDAGDG
YDGGWVAHPGLVSLAMEEFVKVLGDKPNQIGKQRDDVQIEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVTAELV
REYAKVELANVKQVVGGDTAPYDRAAAIFEQMSTSENFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacgctgaagctgccgcaaggcatggcgatcacgggcgaaatcaagcccggc
tacgaagcgatcctcacgcccgaggcgctcgaactcgtcgcgaagctgcatcgccagttc
gagctgcgccgccgcgagctgctcgccgcacgcgtcgagcgcacccagcgcctcgacgcc
ggcgagcgccccgacttcctcgccgaaacgaaatcgatccgcgagggcgactggaagatc
gcgccgctgcccgcggacctgcaatgccgccgcgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggaccaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgaacagaacggcaagtcgtacaagctcaacgacaagatcgcg
acgctgatcgtgcgcccgcgcggctggcacctcgacgaaaagcacgtgacggtggacggt
cagcgcgtgtcgggcggcgtcttcgatttcgccctcttcctgttccacaacgcgcaggag
ctgatcgcgcgcggctcgggcccgtacttctatctgccgaagatggaaagccatctggag
gcgcgcctctggaacgacattttcgtcgccgcgcaggaagcgcttggcgtgccgcgcggc
acgatccgcgcgaccgtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgcgggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctcgccgatcgcgcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaacgcgcccgcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgatcgcgccatggcgggcgtgcgcgcggacaaggcgcgcgacgccggcgacggc
tatgacggcggctgggtcgcgcacccgggcctcgtgtcgctcgcgatggaggagttcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcagatcgag
ggcaagaacctgctcgatttccagccggaagcgccgatcaccgaagccgggctgcgcaac
aacatcaacgtcggcatccactacctcggctcgtggctcgcgggcaacggctgcgtgccg
atccacaacctgatggaagacgcggcgacggccgagatctcgcgctcgcaggtctggcaa
tggatccgttcgccgaagggcacgctcgacgacggccgcaaggtcacggccgagctcgtg
cgcgagtacgcgaaggtcgagctcgcgaacgtgaagcaggttgtcggcggagataccgcg
ccgtacgatcgcgccgcggcgatcttcgagcagatgtcgacgtcggagaacttcaccgag
ttcctgacgctgccgctctacgaagagatctga

DBGET integrated database retrieval system