KEGG   Burkholderia pseudomallei K96243: BPSL2476Help
Entry
BPSL2476          CDS       T00203                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bps00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bps00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:2989550..2990053
Genome map
AA seq 167 aa AA seqDB search
MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRR
NIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEI
DQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgaccttgatcgtcgcgcgcgcccgcaacggcgtgatcggccgcgacaac
cgacttccgtggaaactccccgaggacctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacgcacgaatcgatcggccggccgctgccggggcgccgc
aacatcgtcgtcacgcgcgacgccgcgcgccgcttcgacggctgcgacacggtcacctcg
ctcgacgacgcgctcgcgctcgccgcgcgcgacggcgcggccgaagcgttcctgatcggc
ggcgcgcaactgtacgaggaaggcctgcgccacgcggacaagctgatcgtcaccgaaatc
gatcaggatttcgaaggtgacgcgtcgttccccgcgcccgatcccgcgcaatgggaagcc
gtgtcgcgcgacgcgcaccgcgcggcgcagcccaacgatttcacgtacgcgttcgtcgtc
tatcgccgcaggcgcgccggctga

DBGET integrated database retrieval system