KEGG   Burkholderia pseudomallei K96243: BPSL2666Help
Entry
BPSL2666          CDS       T00203                                 

Gene name
pgm
Definition
phosphoglucomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSL2666 (pgm)
   00030 Pentose phosphate pathway
    BPSL2666 (pgm)
   00051 Fructose and mannose metabolism
    BPSL2666 (pgm)
   00052 Galactose metabolism
    BPSL2666 (pgm)
   00500 Starch and sucrose metabolism
    BPSL2666 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BPSL2666 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BPSL2666 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPSL2666 (pgm)
Enzymes [BR:bps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BPSL2666 (pgm)
    5.4.2.8  phosphomannomutase
     BPSL2666 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:complement(3189170..3190564)
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLARPLKLVVDA
GNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKTTDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLAQWVREKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARAADP
SALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEASSDAALARIQDDFRRALKAAKPDANLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatacgatattcggggcgtgatcggcaagacgctc
gacgccgacgtcgcgcgctcgatcggccgcgcattcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtcgtcgcgcgcgacggccggctctcggggcccgagctcgtcggcgcg
ctcgcggacgggctgcgcgcggcgggcgtcgatgtcgtcgacgtcggcatggtgccgacg
cccgtcggctacttcgcggcgagcgtgccgctcgcgctgtcgggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaatccgcccgactacaacggtttcaagatg
gtcctgcgcggcgccgcgatttacggcgaccagatccagggcctgtacaagcgcatcgtc
gacgcgcgtttcgagaccggcaacggttcgtatgagcgatacgatgtcgccgatcaatac
gttgagcgcatcgtcggcgacatcaggctcgcgcggccgctgaagctcgtcgtcgatgcg
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactc
gtcgagctcttcaccgacatcgacggcaacttcccgaaccaccacccggacccggcgcac
ccggagaacctgcaggacgtgatcgcgaagctgaagacgaccgatgccgagatcggcttc
gcgttcgacggcgacggcgaccgcctcggcgtcgtcacgaaggacggccagatcatctat
ccggaccgccagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgcaatctcgcgcagtgggtgcgcgagaagggcggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgagacgggc
gcgccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggcgcgcgcctgctcgagatcctcgcgcgcgcggccgatccg
agcgcgctgctcaacggcttgccgaacgcggtgtcgacgcccgagctgcaattgaagctc
gacgaaggcgagaacgtgaagctgatcgacaagctgcgcgccgacgcgaagttcgacggc
gcggacgaggtcgtgacgatcgacggtctgcgcgtcgagtatccggacggcttcggtctc
gcgcgttcgtcgaacacgacgcccgtggtcgtgctgcgcttcgaggcgagctccgacgcg
gcgctcgcgcggatccaggacgatttccggcgcgcgctgaaggcggcgaagccggacgcg
aacctgccgttctga

DBGET integrated database retrieval system