KEGG   Burkholderia pseudomallei K96243: BPSL2898Help
Entry
BPSL2898          CDS       T00203                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bps03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:3468011..3468592
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLLEKNPPHILVDCNGVGYEVDVPMSTFYNLPHTGEKVVLLTQLIVREDAHLL
YGFLTPPERSTFRELLKITGVGARMALAVLSGMSVAELSQAVTLQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGPLAGAASPSDHATDILNALVALGYSEKEALAAIKNVPAGTGVS
EGIKLSLKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcaccctcctcgaaaaaaatccgccgcacatcctcgtcgac
tgcaacggcgtcggctacgaagtcgacgtgccgatgagcacgttctacaacctgccgcac
acgggcgagaaggtcgtgctgctgacccagttgatcgtccgcgaggacgcgcacctgctg
tacggctttctcacgccgccggagcgctcgacgttccgcgagttgctcaagatcacgggc
gtcggcgcgcggatggcgcttgccgtgctgtccggcatgagcgtcgcggaactgtcgcaa
gcggtcacgctgcaggacgccgcgcgcctcacccgcgtgcccggcatcggcaagaaaacg
gccgagcgcctgctcctcgagctgaaaggcaagctcggcgccgatctcggcccgctcgcc
ggcgcggcatcgccttccgaccatgcgaccgacatcctcaacgcgctcgtcgcgctcggc
tactcggaaaaggaggcgcttgccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gaaggcatcaagctgtcgctcaaggcgctgtcgaaggcgtaa

DBGET integrated database retrieval system