KEGG   Burkholderia pseudomallei K96243: BPSL2898Help
Entry
BPSL2898          CDS       T00203                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPSL2898 (ruvA)
Enzymes [BR:bps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BPSL2898 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:3468011..3468592
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLLEKNPPHILVDCNGVGYEVDVPMSTFYNLPHTGEKVVLLTQLIVREDAHLL
YGFLTPPERSTFRELLKITGVGARMALAVLSGMSVAELSQAVTLQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGPLAGAASPSDHATDILNALVALGYSEKEALAAIKNVPAGTGVS
EGIKLSLKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcaccctcctcgaaaaaaatccgccgcacatcctcgtcgac
tgcaacggcgtcggctacgaagtcgacgtgccgatgagcacgttctacaacctgccgcac
acgggcgagaaggtcgtgctgctgacccagttgatcgtccgcgaggacgcgcacctgctg
tacggctttctcacgccgccggagcgctcgacgttccgcgagttgctcaagatcacgggc
gtcggcgcgcggatggcgcttgccgtgctgtccggcatgagcgtcgcggaactgtcgcaa
gcggtcacgctgcaggacgccgcgcgcctcacccgcgtgcccggcatcggcaagaaaacg
gccgagcgcctgctcctcgagctgaaaggcaagctcggcgccgatctcggcccgctcgcc
ggcgcggcatcgccttccgaccatgcgaccgacatcctcaacgcgctcgtcgcgctcggc
tactcggaaaaggaggcgcttgccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gaaggcatcaagctgtcgctcaaggcgctgtcgaaggcgtaa

DBGET integrated database retrieval system