KEGG   Burkholderia pseudomallei K96243: BPSL2958Help
Entry
BPSL2958          CDS       T00203                                 

Definition
exported ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bps  Burkholderia pseudomallei K96243
Brite
Enzymes [BR:bps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     BPSL2958
Transfer RNA biogenesis [BR:bps03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    BPSL2958
 Prokaryotic Type
    BPSL2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:complement(3529801..3530232)
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAIVAMGNIGATPGSLVSAAYAREAATVDGAAAQVDTIPASRLPRE
AATTLSLIAAGGPYPYGKDGAVFGNYERILPKMRRGYYHEYTVPTPRTRNRGARRIVCGG
PLRRVDNCYYTGDHYNSFKRIVD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatcgtcgcgatg
ggcaacatcggcgctacgccgggcagtctggtttccgccgcatacgcacgggaagccgcc
acggtcgacggggcggcggcgcaggtcgatacgatccccgcatcccgtttgccgcgcgag
gcagcaaccacgctcagcctgatcgccgcgggcggtccctatccgtacgggaaagacggc
gcggtattcggcaattacgaacggatcttgccgaagatgcggcgcggctattaccacgag
tacacggtgccgacgccgcgcacccgcaatcgcggcgcgcggcgcatcgtctgcggcggc
cccttgaggcgcgtcgacaattgttattacaccggcgaccactacaacagtttcaaacgt
atcgttgattga

DBGET integrated database retrieval system