KEGG   Burkholderia pseudomallei K96243: BPSL3040Help
Entry
BPSL3040          CDS       T00203                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00071  Fatty acid degradation
bps00280  Valine, leucine and isoleucine degradation
bps00281  Geraniol degradation
bps00310  Lysine degradation
bps00360  Phenylalanine metabolism
bps00362  Benzoate degradation
bps00380  Tryptophan metabolism
bps00410  beta-Alanine metabolism
bps00627  Aminobenzoate degradation
bps00640  Propanoate metabolism
bps00650  Butanoate metabolism
bps00903  Limonene and pinene degradation
bps00930  Caprolactam degradation
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01212  Fatty acid metabolism
Module
bps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPSL3040 (paaF)
   00650 Butanoate metabolism
    BPSL3040 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BPSL3040 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPSL3040 (paaF)
   00310 Lysine degradation
    BPSL3040 (paaF)
   00360 Phenylalanine metabolism
    BPSL3040 (paaF)
   00380 Tryptophan metabolism
    BPSL3040 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPSL3040 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPSL3040 (paaF)
   00281 Geraniol degradation
    BPSL3040 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPSL3040 (paaF)
   00627 Aminobenzoate degradation
    BPSL3040 (paaF)
   00930 Caprolactam degradation
    BPSL3040 (paaF)
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPSL3040 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 3092157
NCBI-ProteinID: YP_109635
UniProt: Q63QI3
Position
1:complement(3629441..3630235)
Genome map
AA seq 264 aa AA seqDB search
MIEEKQMAYENILVETRGRVGLITLNRPKALNALNDALMDELGLALKAFDADEGIGAIVL
TGSEKAFAAGADIGMMATYSYMDVFKGDYITRNWETVRQIRKPIIAAVAGFALGGGCELA
MMCDIIFAADTAKFGQPEIKLGVLPGAGGTQRLPRAVSKAKAMDMCLTARFMDAEEAERA
GLVSRILPADKLLDEAIAAATTIAEFSLPAVMMVKEAVNRAYETTLSEGVHFERRLFHSA
FATEDQKEGMAAFVEKRKPVFKHR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggagaagcagatggcttacgagaacattctggtggagacgcggggcagggtg
gggctgattacgctgaaccgtccgaaggcgctgaatgcgttgaatgacgccctgatggat
gaacttggcttggcgctcaaagcgttcgacgcggacgagggtattggcgcgatcgtgctg
acgggcagcgagaaggcgttcgcggcgggcgccgacatcgggatgatggcgacctattca
tacatggacgtcttcaagggcgactacatcacgcgtaactgggagacggtgcgccagatc
cgcaagccgatcatcgcggcggtggcgggtttcgcgctgggcggcggctgcgaactcgcg
atgatgtgcgacatcatctttgcggccgatacggcgaagttcggccagccggaaatcaag
ctcggcgtgctgccgggtgcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcg
aaagcgatggacatgtgcttgaccgcgcgcttcatggacgcggaggaagctgagcgggcg
ggcttggtgtcgaggatcctgccggcggacaagttgctcgacgaggcgatcgccgcggcg
acgacgatcgcggaattctcgctgcctgccgtaatgatggtgaaggaggcggtgaatcgc
gcatacgagacgaccttgtccgaaggggtgcacttcgagcgtcgcttgtttcactcggca
tttgcgactgaagatcagaaggaagggatggcggcgttcgtcgagaagcgcaagcccgtc
ttcaagcatcgctga

DBGET integrated database retrieval system