KEGG   Burkholderia pseudomallei K96243: BPSL3040Help
Entry
BPSL3040          CDS       T00203                                 

Gene name
paaF
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BPSL3040 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPSL3040 (paaF)
   00650 Butanoate metabolism
    BPSL3040 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BPSL3040 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPSL3040 (paaF)
   00310 Lysine degradation
    BPSL3040 (paaF)
   00360 Phenylalanine metabolism
    BPSL3040 (paaF)
   00380 Tryptophan metabolism
    BPSL3040 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPSL3040 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPSL3040 (paaF)
   00281 Geraniol degradation
    BPSL3040 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPSL3040 (paaF)
   00627 Aminobenzoate degradation
    BPSL3040 (paaF)
   00930 Caprolactam degradation
    BPSL3040 (paaF)
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPSL3040 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:complement(3629441..3630235)
Genome map
AA seq 264 aa AA seqDB search
MIEEKQMAYENILVETRGRVGLITLNRPKALNALNDALMDELGLALKAFDADEGIGAIVL
TGSEKAFAAGADIGMMATYSYMDVFKGDYITRNWETVRQIRKPIIAAVAGFALGGGCELA
MMCDIIFAADTAKFGQPEIKLGVLPGAGGTQRLPRAVSKAKAMDMCLTARFMDAEEAERA
GLVSRILPADKLLDEAIAAATTIAEFSLPAVMMVKEAVNRAYETTLSEGVHFERRLFHSA
FATEDQKEGMAAFVEKRKPVFKHR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggagaagcagatggcttacgagaacattctggtggagacgcggggcagggtg
gggctgattacgctgaaccgtccgaaggcgctgaatgcgttgaatgacgccctgatggat
gaacttggcttggcgctcaaagcgttcgacgcggacgagggtattggcgcgatcgtgctg
acgggcagcgagaaggcgttcgcggcgggcgccgacatcgggatgatggcgacctattca
tacatggacgtcttcaagggcgactacatcacgcgtaactgggagacggtgcgccagatc
cgcaagccgatcatcgcggcggtggcgggtttcgcgctgggcggcggctgcgaactcgcg
atgatgtgcgacatcatctttgcggccgatacggcgaagttcggccagccggaaatcaag
ctcggcgtgctgccgggtgcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcg
aaagcgatggacatgtgcttgaccgcgcgcttcatggacgcggaggaagctgagcgggcg
ggcttggtgtcgaggatcctgccggcggacaagttgctcgacgaggcgatcgccgcggcg
acgacgatcgcggaattctcgctgcctgccgtaatgatggtgaaggaggcggtgaatcgc
gcatacgagacgaccttgtccgaaggggtgcacttcgagcgtcgcttgtttcactcggca
tttgcgactgaagatcagaaggaagggatggcggcgttcgtcgagaagcgcaagcccgtc
ttcaagcatcgctga

DBGET integrated database retrieval system