KEGG   Burkholderia pseudomallei K96243: BPSL3058Help
Entry
BPSL3058          CDS       T00203                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bps  Burkholderia pseudomallei K96243
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:complement(3648416..3649153)
Genome map
AA seq 245 aa AA seqDB search
MICMKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGL
YEVNLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKG
NGARKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKS
WQSWMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQA
LAGVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcatgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcg
acgctcggctgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaa
tcgcgcctcggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttg
tacgaggtcaatctcggctcgcagatcgtctatagcgacgcatcgggcgattacgtgctg
ctcggcgagctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgag
atcaacaagatcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggc
aacggcgcgcgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctc
gagacgacgctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctg
tcgcccgattcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaaaagc
tggcagtcgtggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgacc
gcgctcgacaagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgta
ttcctcgccgacggcacgcgcctgccgggcgccgtatccgccgacgaactgaatcaggcg
ctcgccggcgtcaagtga

DBGET integrated database retrieval system