KEGG   Burkholderia pseudomallei K96243: BPSL3183Help
Entry
BPSL3183          CDS       T00203                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bps00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:3791004..3792068
Genome map
AA seq 354 aa AA seqDB search
MSQKFTEGNCKVSSVTYPSHSAMSIHPLHRPRRMRRDDFSRRLMRENILTTNDLIYPVFV
VEGTNVRQPVPSMPGVERVSIDLLMGVAEQCVELGVPVLSLFPAIEPSLKTPDGREAANP
EGLIPRAVRELKRRFPELGVLTDVALDPYTSHGQDGVLDEAGYVLNDETLEILVEQARAQ
AEAGVDIVAPSDMMDGRIGAVREMLEREGHIYTRIMAYSAKYASAFYGPFRDAVGSASNL
GKGNKMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEFRYPTYVYQ
VSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRAGADGILTYFALDAARLLRAQK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcaaaagtttaccgaagggaactgtaaggtttcgtcggttacctatcccagccat
tccgccatgagcatccatcccctgcaccgcccgcgccgcatgcgccgcgacgatttctcg
cgacgcctgatgcgcgaaaatatcctcaccacgaacgatctgatctacccggtgttcgtc
gtcgaaggcacgaacgtgcgccagccggtgccgtcgatgccgggcgtcgagcgcgtgtcg
atcgatctgctgatgggtgtcgccgagcaatgcgtcgagctcggcgtgccggtcctgtcg
ctctttccggccatcgagccgtcgctgaagacgcccgacggccgcgaagcggccaatccc
gaagggctgatcccgcgtgcggtacgcgagctgaagcgccgcttccccgaactcggcgtg
ctgaccgacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgag
gccggctatgtgctcaacgacgaaacgctcgagattctcgtcgagcaggcgcgcgcgcag
gccgaagcgggtgtcgacatcgtcgcgccgtcggacatgatggacgggcgcatcggcgcg
gtgcgcgagatgctcgagcgtgaaggccacatctacacgcggatcatggcctactcggcg
aagtacgcgtcggcgttctacggcccgttccgcgacgcggtcggctccgcgtcgaatctc
ggcaagggcaacaagatgacctaccagatggaccccgcgaacagcgacgaggcgctgcgc
gaagtgcgcctcgacatcgacgagggcgcggacatggtcatggtgaagcccggcatgccg
tatctcgacatcgtgcgccgcgtgaaggacgaattccgctatccgacctacgtctatcag
gtgagcggcgaatacgcgatgctgaaggccgccgcgcagaacggctggctcgatcacgac
aaagtcgtgctcgaatcgctgctcgcgttcaagcgcgcgggcgcggacggcattctcacg
tacttcgcgctcgacgcggcgcggctgctgcgcgcgcagaagtaa

DBGET integrated database retrieval system