KEGG   Burkholderia pseudomallei K96243: BPSL3183Help
Entry
BPSL3183          CDS       T00203                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPSL3183 (hemB)
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BPSL3183 (hemB)
Exosome [BR:bps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPSL3183 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:3791004..3792068
Genome map
AA seq 354 aa AA seqDB search
MSQKFTEGNCKVSSVTYPSHSAMSIHPLHRPRRMRRDDFSRRLMRENILTTNDLIYPVFV
VEGTNVRQPVPSMPGVERVSIDLLMGVAEQCVELGVPVLSLFPAIEPSLKTPDGREAANP
EGLIPRAVRELKRRFPELGVLTDVALDPYTSHGQDGVLDEAGYVLNDETLEILVEQARAQ
AEAGVDIVAPSDMMDGRIGAVREMLEREGHIYTRIMAYSAKYASAFYGPFRDAVGSASNL
GKGNKMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEFRYPTYVYQ
VSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRAGADGILTYFALDAARLLRAQK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcaaaagtttaccgaagggaactgtaaggtttcgtcggttacctatcccagccat
tccgccatgagcatccatcccctgcaccgcccgcgccgcatgcgccgcgacgatttctcg
cgacgcctgatgcgcgaaaatatcctcaccacgaacgatctgatctacccggtgttcgtc
gtcgaaggcacgaacgtgcgccagccggtgccgtcgatgccgggcgtcgagcgcgtgtcg
atcgatctgctgatgggtgtcgccgagcaatgcgtcgagctcggcgtgccggtcctgtcg
ctctttccggccatcgagccgtcgctgaagacgcccgacggccgcgaagcggccaatccc
gaagggctgatcccgcgtgcggtacgcgagctgaagcgccgcttccccgaactcggcgtg
ctgaccgacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgag
gccggctatgtgctcaacgacgaaacgctcgagattctcgtcgagcaggcgcgcgcgcag
gccgaagcgggtgtcgacatcgtcgcgccgtcggacatgatggacgggcgcatcggcgcg
gtgcgcgagatgctcgagcgtgaaggccacatctacacgcggatcatggcctactcggcg
aagtacgcgtcggcgttctacggcccgttccgcgacgcggtcggctccgcgtcgaatctc
ggcaagggcaacaagatgacctaccagatggaccccgcgaacagcgacgaggcgctgcgc
gaagtgcgcctcgacatcgacgagggcgcggacatggtcatggtgaagcccggcatgccg
tatctcgacatcgtgcgccgcgtgaaggacgaattccgctatccgacctacgtctatcag
gtgagcggcgaatacgcgatgctgaaggccgccgcgcagaacggctggctcgatcacgac
aaagtcgtgctcgaatcgctgctcgcgttcaagcgcgcgggcgcggacggcattctcacg
tacttcgcgctcgacgcggcgcggctgctgcgcgcgcagaagtaa

DBGET integrated database retrieval system