KEGG   Burkholderia pseudomallei K96243: BPSS0017Help
Entry
BPSS0017          CDS       T00203                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BPSS0017
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BPSS0017
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BPSS0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(16285..17070)
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAGGRAIGV
AMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgaatggcaaaaccgccatcgtgacgggcgcggcgagcggcatcggcaag
gaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcgatcgccgatctgaaccag
gacggcgcgaacgcggtggccgagctcatcgagcaggcgggcggccgggcgatcggcgtg
gcgatggacgtgacgaacgaggacgcggtgaacgccggcatcgacaaggtcgcccagacg
ttcggctcggtcgacattctcgtgtcgaacgcgggcatccagatcgtcaatccgatcgag
aactatgcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttcctg
acgacgaaggccgcactcaagcacatgtacaaggacgatcgcggcggagtggtgatctac
atgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggccaag
cacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtgcgc
tcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtcgacaagcagattccggag
caggccaaggagctcggcatcagcgaagaggaggtggtgaagaaggtgatgctcggccag
acggtggacggcgtattcacgacggtcgaggacgtcgcgaagacggtgctgttcctgtcc
gcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtcagccacggctggttcatg
caatga

DBGET integrated database retrieval system