KEGG   Burkholderia pseudomallei K96243: BPSS0040Help
Entry
BPSS0040          CDS       T00203                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPSS0040 (folE)
Enzymes [BR:bps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BPSS0040 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(39410..39964)
Genome map
AA seq 184 aa AA seqDB search
MLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEPRDILARTFSEVDGYDEMIVLKDI
RFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQIQEKMTVQIADTLFD
VLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPATRREFLSIVANPSSVN
LTNT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctgcggtgggccggcgacgatccgcaacgcgaggggctcgtcgatacgccggcg
cgcgtcgtgcgcgcctacgaggagttcttcgccggctacgcgctcgaaccgcgcgacatc
ctcgcgcgcacgttcagcgaggtcgacggctacgacgaaatgatcgtgctgaaggacatc
cgcttcgaaagctattgcgagcaccatatggtgccgatcatcggccgcgcgcacgtcgca
tatctgccgaaccatcgcgtcgtgggcatctcgaagctcgcgcgcctcgtcgatgcgttc
gcgaagcgcctgcagatccaggaaaagatgacggtgcagatcgccgatacgctgttcgac
gtgctgcagccgaagggcgtcggcgtgattctcgaagcggcgcaccagtgcatctcgacg
cgcggcatccacaagcccggcgtcgagatggtgacgtcgcggatgctcggcacgttccgc
accgatccggccacgcgccgcgaattcctgtcgatcgtcgcgaatccttcctcggtcaac
ctgacgaacacctaa

DBGET integrated database retrieval system