KEGG   Burkholderia pseudomallei K96243: BPSS0144Help
Entry
BPSS0144          CDS       T00203                                 

Definition
amylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPSS0144
Enzymes [BR:bps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BPSS0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(186668..189283)
Genome map
AA seq 871 aa AA seqDB search
MLVGSLAALAGAAALPANTSAAAEAFGSPGAAPVRGPAAKSFLGTAVNGASRVYFTGYRG
ILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMSWQVTTGNSSHN
WQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYLDNAGANNTAQTVSGSGG
TALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADKTMDWTFSSAT
NGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAGEQQQYDTGWHN
YAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDANAGGYHLVWPR
DLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGYSRVGRFPQNAW
VNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPWTYQERWEENA
GYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTYTSSGAFGNGSY
YIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGGFFELVRMGVKR
ATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGGDFDGTGAGRLW
PIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTLPDGWAVTTPAG
YTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAPPQSGQVPVAVN
VNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQAIQYKYYRKNA
DGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgggcagtctggccgcgctcgcgggcgcggcggccctaccggcgaatacttcg
gccgccgccgaagcattcggctcgcccggcgccgcgcccgtgcggggcccggcggccaag
tcgttcctcggcacggcggtcaacggcgcatcgcgggtgtacttcaccggttatcgcggc
atcctgtccgaggtctactacccggtcctcgatacgcccgagtccgtcgacctgcagttc
ctcgtcggcgacgccggcaagaccttcgtcgacgaagaaaagcagcaggcctactcggcc
gcgcaaacggacacgcgcacgatgagctggcaggtgacgaccggcaacagttcgcacaac
tggcaaattcgcaagatcgtcttcgccgatccgaaccacaacgcgatcgtgcagcgcgtc
acgttcaccgcgctcaacggccgcaaggtgggcgacttcaatctctacatgctgtccaag
ccgtacctcgacaacgccggcgccaacaataccgcgcaaacggtgtccggcagcggcggc
accgcgctcgtcgcgaatcacaacagccgctattcggcgctcgtcgcgagccgcccgtgg
aaggtggtcaacggcgtgggcatgacgtcgaacggcttcgtcgggcagagcgacggctgg
accgacctgctcggcggcaccgccgacaagacgatggactggaccttctcgtccgcgacc
aacggcaacgtcgcgcagatgggctggctcgacctcggcgatccgagcgcgacgagcgtg
tcgttcgacgtcgtgctcggcttcggcggcacgcaggaccaggcgctcggcgacgcgaac
acggtgctcggcagcgatctcgccggcgagcagcagcagtacgacaccgggtggcataac
tacgcggcgggcctgtcgtcgcagaacggcgccgcggacgacggctactacctggccgcg
atgacgctcaagacgatgcaggacaagagcaacggcgcgatgatcgccggcatcggcacg
ccgtggggcgaaacgcagggcgatgcgaacgcgggcggctatcacctcgtgtggccgcgc
gacctgttcaagttcgcgaacgcgctgacgacggcgggcgacacgtcgagcgcgacgagc
gtcgtcaactacctgttcaacacgctgcagcagacaaccgattgcggcaccgccgaatac
aacgcgcccggctgcgcgcagggctacagccgcgtcgggcgctttccgcagaacgcatgg
gtgaacggctggccgtactggcagggcacgcagatggacgagcaggcgatgccgatcatc
ctcgcgtggcgcctcggcccgagcgtgttcaatccgctgtggccgaagatcaagctcacc
gccgactacatcgtcaataccggcccctggacgtaccaggagcgctgggaggagaacgcc
ggctattcgccgtcgacgatcgccgccgagatcgcgggcctcgtcacggcggccgatatc
gcgacgcaaaacggcgacacggcgagcgccgcgcgctacctcgccgcggccgactactgg
caggagaacgtcgcggcgtggacgtacacgtcgagcggcgcgttcggcaacggcagctac
tacatccggatcaatccggcgggccgcgcgggcaccggcaccgaccgcgcgagcttcgcg
ccgaccgccggccccgacacgccgcagacgctgagcgtgaagaacggcggcggcagccac
gacgcgcggcgcgtcgtcgacggcggcttcttcgagctcgtccggatgggggtcaagcgc
gcgaccgatccgacgatcgccaacacgatctcggtctacgacagcgtgctcggccagacg
ctgaacgtcgcgaacgcgccggcgctgtcgccgaacgcgtggttccgctacaacttcgac
ggctacggcgagcacaacgacggcggcgatttcgacggcaccggcgccggccggctgtgg
ccgatcttcaccgccgagcgcggcatggtcgagatcgcgcgccagggcagcggcggcgcg
ggcagcgcgtacttctcgacgctcaagcaattgacgacgcccgagggcttcgtgccggag
caggtgtggtcgaattcgacgacgctgcccgacggctgggcggtgacgacgcccgcgggc
tacacgccgggccagccgaccaaatcgatggcgccgctcaactgggcgatgggcgaatac
atcagcctgctcgcgtcgatccaggcggggcgcatcgtcgacgtgccgtcggtggtctgc
gcgcgctacaacaactgcgccgcgccgccgcaaagcgggcaggtgccggtggccgtcaac
gtgaacgcgagcacgcagctcggccagcagatgtacgtgacaggcaacgtcgccgcgctc
ggcaattggaacaccgatctcggcattccggtcgatccggccagctacccggtgtggcgc
aacaccgtcaacctgccggccgctcaggcgatccagtacaagtactaccggaagaacgcg
gacggcagcgtgacgtgggagaaccgttccggcaaccgccagcttcagacgcccgcgagc
ggcacgttggcgctgaacgatcaggtgagctggtga

DBGET integrated database retrieval system