KEGG   Burkholderia pseudomallei K96243: BPSS0163Help
Entry
BPSS0163          CDS       T00203                                 

Gene name
asnO
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bps00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:215120..216988
Genome map
AA seq 622 aa AA seqDB search
MCGITGWIDFARDLRNEAPIVDTMTDTLARRGPDARGVWLDTHAALGHRRLSIIDPERGA
QPMLTPERGPRGLPRAVISYAGETYNFRELRAELGALGHRFDTHCDTEVVLRAYLEWGAA
FVDRLNGMYSIAIWDTARDELLLVRDRLGVKPLFYYPTADGVIFGSEPKAILAHPDVRAR
TSSEGLCDALLFLRTPGQVPFSGMREVKPGHVLRVRRGGLAEQRYWALEARPHTDDLPTT
IATIRALLDDIVSRQMISDVPLCALLSGGVDSSTIAALAQKRRRASGGGALSTFCVDFTG
HTRNFRADPIRPTADAPFALEVARHIGSDHHTIELDQAGLLDPQVREAVLRAWDLPFNFA
DLDVSLHRLFAEVRKHATVALSGEAADEIFGGYLWFSDPAARRAHTFPWLKLGAHRGLDP
RALFHRSFIDALRLGEYEAQLYRAALAEVPRLDGENAEDRRTRELHYLTLTRWLPVLLDK
KDRMGMASGLEGRVPFCDHRLVEYVFNIPWAMKTFSGQEKALLRAAAADLLPESVLNRKK
AAYPSIQAPGYDRGLIERLNRAIAAGRAPLEPFIDAGALRGLTEKTAAGSLSEFERILLE
SSSRLNDWLDLYRVELDGVPAG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcaccggatggatcgatttcgcccgcgatctgcgcaacgaagcgccgatc
gtcgacacgatgaccgatacgctcgcgcgccgcgggcccgatgcgcgcggcgtgtggctc
gacacgcacgccgcgctggggcaccggcggctatcgatcatcgatcccgagcgcggcgcg
cagccgatgctcacgcccgagcgcgggccgcgcggcctgccgcgcgcggtcatctcgtat
gcgggcgaaacctacaacttccgcgaattgcgggccgagctgggcgcgctcggccaccgg
ttcgacacgcattgcgataccgaggtcgtgctgcgcgcgtatctcgaatggggcgcggcg
ttcgtcgaccgcctcaacgggatgtattcgatcgcgatctgggataccgcgcgcgacgaa
ctgctgctcgtgcgcgaccggctcggcgtgaagccgctgttctactatccgacggcggac
ggcgtgatcttcggctcggagccgaaggcgatcctcgcgcatcccgacgtgcgcgcgcgc
acgtcgtcggaggggctttgcgatgcgctgctgttcctgcgcacgccggggcaggtgccg
ttctcggggatgcgcgaggtgaagcccggccatgtgctgcgcgtgcggcgcggcggcctc
gccgagcaacgctactgggcgctcgaagcgcgcccgcacaccgacgatctgccgacgacg
atcgcgacgatccgcgcgctgctcgacgacatcgtgtcgcgccagatgatctcggacgtg
ccgctgtgcgcgctgctgtcgggcggcgtcgattcgagcaccatcgccgcgctcgcgcag
aagcggcggcgcgcgagcggcggcggcgcgttgtcgacattctgcgtcgatttcaccggc
cacacgcgcaactttcgcgccgatccgattcgcccgacggccgatgcgccgttcgcgctc
gaagttgcgcggcacatcggcagcgatcaccacacgatcgagctggaccaggccgggctg
ctcgatccgcaggtgcgcgaagcggtgctgcgcgcgtgggacttgccgttcaacttcgcc
gatctcgacgtgtcgctgcaccggctgttcgccgaggtccgcaagcacgccaccgtcgcg
ctatccggcgaggcggccgacgagatcttcggcggctacctgtggttctccgatccggcc
gcgcggcgtgcacacacgttcccgtggctgaagctgggcgcgcatcgcgggctcgatccg
cgcgcgctgtttcatcggtcgttcatcgacgcgctgcgactcggcgaatacgaagcacag
ctctaccgcgcggcgctcgccgaagtgccgcgcctcgacggcgagaacgcggaggaccgc
cgcacgcgcgagctgcattacctgacgctcacgcgctggctgccggtgctgctcgacaag
aaggaccggatggggatggcaagcggcctcgaggggcgcgtgccgttctgcgatcaccgg
ctcgtcgagtatgtgttcaatatcccgtgggcgatgaagacgttcagcggccaggagaag
gcgctgctgcgcgcggcggcggccgatctgttgcccgaatcggtgctgaaccgcaagaag
gccgcgtatccgtcgattcaggcgccgggctatgaccgcggcctgatcgagcgcctcaat
cgcgcgatcgcggccggccgcgcgccgctcgaaccgttcatcgacgccggcgcgctgcgc
ggcctgaccgagaagaccgccgccggcagcctttcggaattcgaacgaatcctgctggag
tcgagcagccggctcaacgactggctcgatctctatcgtgtcgagctcgacggcgtgccg
gcgggctga

DBGET integrated database retrieval system