KEGG   Burkholderia pseudomallei K96243: BPSS0509Help
Entry
BPSS0509          CDS       T00203                                 

Definition
hypothetical protein
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bps00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(693569..695203)
Genome map
AA seq 544 aa AA seqDB search
MLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQVVDVLEF
MADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKQFPKTNSFIDGERQPLA
EIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRRANAYAQAGADAILIHSKL
SRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTVIWANHLIRASASAMQAVA
REIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSSARASSAALVLAASRGNGL
EAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYRADAIDTSGVKLVVNERHA
QTGELASLACAAERLTGDTIISYGDLLFRSYILRDLAESEAQFSVVVDSSQTQPSNQSVR
DFAFCSAADDRGLFGQKAYLRRVSSDASEAAPHGRWIGLLNVRGAGVARLKAMLGTLQAR
DDFDALDLPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRRAGDFAHGQTPYAEQNAGS
GSAR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgc
atcgtccgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaa
ttcggcgtgcgcgacaacaacgaggcgagctggacacaggtggtcgacgtgctcgaattc
atggccgacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttc
aacaacgtgcgccggctcgtgagaaagctcgagcagcgcggcatcgccggcgtgtgcatc
gaggacaagcagtttccgaaaaccaacagcttcatcgacggcgagcgccagccgctcgcc
gagatcgacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggat
ttctcgatcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctg
cgccgcgcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctg
tcgcgcccggacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtg
atcgtgccgaccaagtactacagcacgccgaccgacgtgttccgccaggcgggcatcagc
accgtgatctgggcgaaccatctgatccgcgcgtccgcttccgcgatgcaggcggtcgcc
cgtgaaatccaggacagcgaaacgctcgtcaacgtcgaggaacgcgtggcgagcgtcaac
gagatcttccggctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcg
tcgagcgcgcgcgcgtcgagcgcggcgctcgtgctcgccgcgagccgcggcaacgggctc
gaggccgtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgttg
cgctggctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggc
taccgcgccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcg
caaacgggcgagctcgcgtcgctcgcctgcgcggccgagcgtctgacgggcgacaccatc
atctcgtacggcgatctgctgtttcgcagctacatcctgcgcgacctcgcggaaagcgag
gcgcagttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgc
gatttcgcattctgctcggccgccgacgaccgcgggctgttcggccagaaagcgtacctg
cgccgcgtgtcgagcgacgcgagcgaggccgcgccgcacgggcgctggatcggcctgctg
aacgtgcgcggcgcgggcgtcgcgcggctgaaggcgatgctcggtacgctccaggcgcgc
gacgatttcgatgcgctcgacctgccggcgctgctgaacgcgctcgtcgacgcgggcgag
cagatcgaagtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttc
cgccgcgcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcagc
gggagcgcacgatga

DBGET integrated database retrieval system