KEGG   Burkholderia pseudomallei K96243: BPSS0509Help
Entry
BPSS0509          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00440  Phosphonate and phosphinate metabolism
bps01100  Metabolic pathways
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BPSS0509
Enzymes [BR:bps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BPSS0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD
Motif
Other DBs
NCBI-GeneID: 3095956
NCBI-ProteinID: YP_110530
UniProt: Q63MY9
Position
2:complement(693569..695203)
Genome map
AA seq 544 aa AA seqDB search
MLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQVVDVLEF
MADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKQFPKTNSFIDGERQPLA
EIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRRANAYAQAGADAILIHSKL
SRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTVIWANHLIRASASAMQAVA
REIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSSARASSAALVLAASRGNGL
EAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYRADAIDTSGVKLVVNERHA
QTGELASLACAAERLTGDTIISYGDLLFRSYILRDLAESEAQFSVVVDSSQTQPSNQSVR
DFAFCSAADDRGLFGQKAYLRRVSSDASEAAPHGRWIGLLNVRGAGVARLKAMLGTLQAR
DDFDALDLPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRRAGDFAHGQTPYAEQNAGS
GSAR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgc
atcgtccgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaa
ttcggcgtgcgcgacaacaacgaggcgagctggacacaggtggtcgacgtgctcgaattc
atggccgacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttc
aacaacgtgcgccggctcgtgagaaagctcgagcagcgcggcatcgccggcgtgtgcatc
gaggacaagcagtttccgaaaaccaacagcttcatcgacggcgagcgccagccgctcgcc
gagatcgacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggat
ttctcgatcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctg
cgccgcgcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctg
tcgcgcccggacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtg
atcgtgccgaccaagtactacagcacgccgaccgacgtgttccgccaggcgggcatcagc
accgtgatctgggcgaaccatctgatccgcgcgtccgcttccgcgatgcaggcggtcgcc
cgtgaaatccaggacagcgaaacgctcgtcaacgtcgaggaacgcgtggcgagcgtcaac
gagatcttccggctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcg
tcgagcgcgcgcgcgtcgagcgcggcgctcgtgctcgccgcgagccgcggcaacgggctc
gaggccgtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgttg
cgctggctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggc
taccgcgccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcg
caaacgggcgagctcgcgtcgctcgcctgcgcggccgagcgtctgacgggcgacaccatc
atctcgtacggcgatctgctgtttcgcagctacatcctgcgcgacctcgcggaaagcgag
gcgcagttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgc
gatttcgcattctgctcggccgccgacgaccgcgggctgttcggccagaaagcgtacctg
cgccgcgtgtcgagcgacgcgagcgaggccgcgccgcacgggcgctggatcggcctgctg
aacgtgcgcggcgcgggcgtcgcgcggctgaaggcgatgctcggtacgctccaggcgcgc
gacgatttcgatgcgctcgacctgccggcgctgctgaacgcgctcgtcgacgcgggcgag
cagatcgaagtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttc
cgccgcgcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcagc
gggagcgcacgatga

DBGET integrated database retrieval system