KEGG   Burkholderia pseudomallei K96243: BPSS0545Help
Entry
BPSS0545          CDS       T00203                                 

Gene name
fdhA
Definition
(RefSeq) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00625  Chloroalkane and chloroalkene degradation
bps00680  Methane metabolism
bps01100  Metabolic pathways
bps01120  Microbial metabolism in diverse environments
bps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BPSS0545 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPSS0545 (fdhA)
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BPSS0545 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc YjeF_N
Motif
Other DBs
NCBI-GeneID: 3095054
NCBI-ProteinID: YP_110566
UniProt: Q63MV3
Position
2:744930..746129
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYQGPGKVEVRKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVIEVGRDVETLKIGDLVSVPFNVACGRCAMCKEQHTGVCLNVNPARA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMAKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAERLAHAKAMGFEVVDLSKD
ATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAQEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAVDVAAKHGSLSIRFGLGWAKSHSFHTGQTPVLKYSRNLMQAILFDRLPIA
EIVNVAVISLDDAPEGYKKFDGGAPRKFVIDPHGMLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaccgaggtgtcgtgtatcaggggccgggcaaggtcgaagtgcggaagatc
gactatccgaagatggtcgatccgagcggccgtgcgatcggccacggcgtgatcctgaag
gtcgtcagcacgaatatctgcggctccgatcagcacatggtgcgcggccgcacgacggcg
cccgtcggtctcgtgctcggccacgagatcacgggcgaggtgatcgaggtcggccgcgat
gtcgagacgctgaagatcggcgatctcgtatcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggagcagcacacgggcgtgtgcctgaacgtgaatccggcgcgcgcg
ggcggcgcgtacggctatgtcgacatgggcggctggatcggcgggcaagccgaatacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatggcg
aagatacgcgatctcacgtgcctgtcggacatcctgccgaccggctatcacggcgcggtc
acggccggcgtgaagcccggctcgaccgtctacgtcgcgggcgcgggcccggtggggatg
gcggccgccgcgtcggcgcggctgctcggcgccgcatgcacgatcgtcggcgacatgaac
gccgagcgcctcgcgcacgcgaaggcgatgggcttcgaggtggtcgatctgtcgaaggac
gcgacgctcggcgagcagatcgaacaaatcctcggcaagccggagatcgattgcgcggtt
gactgcgtcggcttcgaggcgcacggccacggctcgtccggccatgcgcaggaggcgccc
gcgacggtgctgaactcgctgatggaaatcacccggcccgcgggcgcgatcggcattccg
ggcctgtacgtgaccgacgatccgggcgccgtcgatgtcgccgccaagcacggcagcctg
agcattcgtttcggtctcggctgggcgaaatcgcattcgttccataccggccagacgccc
gtgctcaagtacagccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
gaaatcgtcaacgtggcggtgatttcgctcgacgacgcgccggagggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system