KEGG   Burkholderia pseudomallei K96243: BPSS0628Help
Entry
BPSS0628          CDS       T00203                                 

Gene name
glsA
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00220  Arginine biosynthesis
bps00250  Alanine, aspartate and glutamate metabolism
bps00471  D-Glutamine and D-glutamate metabolism
bps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPSS0628 (glsA)
   00220 Arginine biosynthesis
    BPSS0628 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BPSS0628 (glsA)
Enzymes [BR:bps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BPSS0628 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 3095799
NCBI-ProteinID: YP_110649
UniProt: Q63MM2
Position
2:complement(857404..858318)
Genome map
AA seq 304 aa AA seqDB search
MDYQPILERIHTELAPWIGAGRVADYIPELAKVPAERFGMAVVTLDGRIHTVGDARERFS
IQSISKLFACTLAFQLLGDALWERVGREPSGNAFNSLVQLESERGIPRNPFINAGALIVT
DVLCRRFVGAETALVQFMRRLTGVAELDYDLRVASSELAHAERNRAMAHFMASFGNLHMP
PETVIDAYCRQCAIEMNCIELATAALFLANAGVAPVSGERILDASSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDANGNSVAGVQALEQLTTLTG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggattatcagccgattctcgaacgcatccacaccgaactcgcgccctggatcggcgcg
ggccgcgtcgccgactacatccccgaactcgcgaaagtgccggccgagcggttcggcatg
gccgtcgtcacgctcgacggccgcatccacacggtcggcgacgcgcgcgaacgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagttgctcggcgatgcg
ctgtgggaacgggtcggccgagagccgtcgggcaacgcgttcaactcgctcgttcagctc
gaaagcgagcgcggcataccgcgcaatccgttcatcaatgcgggggcgctgatcgtcacc
gacgtcctgtgccgccgcttcgtcggcgccgagacggcgctcgtccagttcatgcgccgt
ctgacaggcgtcgccgagctcgactacgatctgcgcgtcgcgagctccgagctcgcccat
gccgaacgcaatcgcgcgatggcgcacttcatggcgagcttcggcaatctgcacatgccg
cccgagacggtgatcgacgcctattgccgccagtgtgcgatcgagatgaactgcatcgag
ctggcgaccgcggcgctctttctcgccaacgcgggcgttgcgcccgtatccggcgaacgc
attctcgatgccagctcggccaagcgcctgtccgccctcatgctgacatgcggcacgtac
gacgcggcaggcgatttcgtgtatcgcgtcggcctgcccgcgaaaagcggcgtgggcggc
ggcatcgtcgccgtgctgccgggcgagatggccgtgtgcgtctggtcgcccgggctcgac
gcaaacggcaactccgtcgccggcgttcaggcgctcgaacagttgaccacgctgaccggc
cggtcgattttctga

DBGET integrated database retrieval system