KEGG   Burkholderia pseudomallei K96243: BPSS0716Help
Entry
BPSS0716          CDS       T00203                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bps  Burkholderia pseudomallei K96243
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(963917..964753)
Genome map
AA seq 278 aa AA seqDB search
MNERARAMTGRTGILLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTRPEDLVDVR
AEAWLDAVTAQYRALEREYDTVHVAGMCMGALVALLLCRRVRHARGRLALLAAPMFIDGW
STPWYRSLRHLLYRVPGVPARLRVDEDEPFGIKNPTIRAIVKKKFERQDNFHYPWVPLAC
IRQVDRLRSWARAAAADTHCPTLVLHAREDELTSLRSADFLLKHLPDARGIVLENSYHMI
CADNDRDEVARQVLTFFGFDPSHAMSPAMARRMGRADP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcgggcgcgcgccatgaccggccgaacgggcattctgctgatccacgggctc
ggcgggacgcagtacgatctcggctcgctgcacaaggcgatgcgccgggcgggcggcgac
acgcacatgatcacgctgccggggcacggcacgcgccccgaggatctcgtcgacgtgcgc
gcggaagcgtggctcgacgcggtcaccgcgcagtatcgcgcgctcgagcgcgagtacgac
accgtgcatgtcgcgggcatgtgcatgggcgcgctcgtcgcgctgctgctgtgccggcgc
gtgcggcacgcgcgcgggcggctcgcgctgttggccgcgccgatgttcatcgacggctgg
tcgacgccctggtaccgatcgctgcgacatctgctgtaccgcgtgcccggcgtgccggcg
cggctgcgcgtcgacgaggacgagccgttcggcatcaagaacccgacgattcgcgcgatc
gtgaagaagaagttcgagcgtcaggacaacttccactatccgtgggtgccgcttgcatgc
atccgccaggtcgatcgcctgcgaagctgggcgcgcgcggcggcggccgacacgcactgc
ccgacgctcgtgctgcatgcgcgcgaggacgagctcacgagcctgcgctcggcggacttc
ctgctgaagcacctgcccgacgcgcgcgggatcgtgctggagaacagctaccacatgatc
tgcgcggacaacgatcgcgacgaagtcgcccggcaggtgctgacgtttttcggcttcgat
ccgtcgcatgcgatgagcccggcgatggcgcgccggatggggcgcgccgatccgtga

DBGET integrated database retrieval system