KEGG   Burkholderia pseudomallei K96243: BPSS0820Help
Entry
BPSS0820          CDS       T00203                                 

Definition
tRNA synthetase
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bps00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:1104095..1106299
Genome map
AA seq 734 aa AA seqDB search
MSAPHADGARHAPPYRPQALEPRWQSAWRDARLFDADPQPGRPKWFIVELPPFATGQLHM
GHARNYVLADADARFRRMQGYNVLYTTGFDTFGLPTELAAREAGCAPERLARECSEAMAA
QFVRLGLGHDSRRITQYHVPAYYRWVQWVFLRLFEAGHCFRRDAPVAWCPQCEVTLAASL
VDDGRCWRCKRVVSTVVQPQWFVRESTFADEMLDGLDRLAGWPDEVKKIHRDWIGRREGL
RLRLPVRGRAHGLALHLDDAGWLPGVRFVAVGRRHPLAAAALRDGVQPGETILLADVAQA
AGAAGVVELPIIVEDAPGDAARAGRPDAVAADRALAERHALAAPSPGAGGAPAVCDLDAM
LAAGQAERVVGYRLQDWNIARNRYWGPPVPIVHCAACGPVAVPEHALPVRLPEDVDLSRP
GNPLEHHARFRDVRCPRCGASARRDAQTLEAYSSPWWYHWMCKRVDVDDPFNRDDANAWL
PVDLMIGGADQVRTCFFHVRMIARALRGMGIADVDEPVTTLLALGMVKQDDRKMSKSAGN
AVSLASIIERYGADALRLAIIGAAAPENDVNWSDDLVRRQRAFVARLWAFVHRVAETEAG
IAAAHDAGDPPAAGRPDALQRRMQDWLATGGRRIAADFRRHDYHLALKNLAFLFERLQAF
DAAMRRRAPPRAEDVAILAGATRQLVLFLGPFAPHVAEELWQALGGAGLVAGAAWPGADV
VRSSAATAKREAFA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccgcacgcggacggggcgcgccacgcgccgccgtatcggccgcaggcgctc
gagccgcgctggcagagcgcatggcgcgatgcgcgcttgttcgacgcggatccgcagccg
gggcggccgaagtggttcatcgtcgaattgccgccgttcgcgacgggccagttgcacatg
gggcacgcgcggaactacgtgctcgccgatgccgacgcgcggtttcggcgaatgcagggc
tacaacgtgctgtatacgacaggcttcgacacgttcggcctgccgaccgagctggccgcg
cgggaggcgggctgcgcgcccgagcgcctcgcgcgcgaatgcagcgaggcgatggccgcg
cagttcgtgcggctcgggctcgggcacgacagccggcgcatcacgcaatatcacgtgccg
gcgtactaccgctgggttcagtgggtgttcctgcggctgttcgaggccggccactgcttc
cggcgcgatgcgcctgtcgcgtggtgcccgcaatgcgaggtgacgctcgccgcgagcctc
gtcgacgacgggcggtgctggcgctgcaagcgcgtcgtcagcacggtcgtgcagccgcag
tggttcgtgcgcgaatcgacgttcgcggacgaaatgctcgacgggctggatcggctcgcg
ggctggcccgacgaagtgaagaagatccatcgcgactggatcggccggcgcgagggcctg
cgcttgcgcttgccggttcgcggccgcgcgcacgggctcgcgttgcacctcgacgatgcc
gggtggctgcccggagtgcggttcgtcgccgtcgggcggcggcatccgctcgccgccgcc
gcgcttcgcgacggggttcagcccggcgagacgatcctgctcgcggacgttgcgcaggcc
gccggcgcggcgggcgtcgtcgagctgccgatcatcgtcgaagacgcgcccggcgacgcg
gcgcgcgccggccgccccgacgcggtggcggcggaccgcgcgctcgccgagcggcacgcg
ctcgccgcgccgtcgcccggtgcgggcggcgcgcccgccgtgtgcgacctcgacgcgatg
ctcgccgcggggcaggccgagcgcgtcgtcggctaccggctgcaggactggaacatcgcc
cgcaaccgctactgggggccgcccgtgccgatcgtgcactgcgcggcgtgcggccccgtc
gcggtgcccgagcacgcattgcccgtgcggctgccggaggacgtcgatctgagccggccc
ggcaatccgctcgagcaccacgcgcgctttcgcgacgtgcgctgcccgcgctgcggcgcg
agcgcgcggcgcgacgcgcaaaccctcgaagcctattcgagcccgtggtggtaccactgg
atgtgcaagcgcgtcgatgtcgacgatccgttcaaccgcgacgacgcgaacgcatggctg
ccggtggatctgatgatcggcggcgccgaccaggtgcgaacctgcttcttccacgtgcgg
atgatcgcgcgcgcgctgcgcgggatgggcatcgccgatgtcgacgagcccgtgacgacg
ctgctcgcgctcggcatggtcaagcaggacgaccgcaagatgagcaagagcgcgggcaac
gcggtgagcctcgcatcgatcatcgagcgctacggcgccgacgcgctgcgcctcgcgatc
atcggcgcggccgcgcccgagaacgacgtcaactggtcggacgacctcgtgcgccggcag
cgcgcgttcgtcgcgcggctgtgggcgttcgtccaccgggtcgccgagaccgaagccggc
atcgccgccgcgcacgacgcgggcgatccgccggccgccggccggcccgatgcgctgcaa
cggcgaatgcaggattggctcgcgacgggcggccggcggatcgcggccgatttccggcgg
cacgactatcacctcgcgctcaagaatctcgcgttcctgttcgagcgcctgcaggcgttc
gacgcggcgatgcgcaggcgtgcgccgccgcgcgccgaggatgtcgcgatcctcgccggc
gcgacccggcaactggtgttgtttctcggcccgttcgcgccgcacgtcgccgaggagctc
tggcaggcgctcggcggcgcggggctggtggcgggcgccgcctggcccggcgcggacgtt
gtgcgctcatccgccgcgacggcgaaacgggaggccttcgcatga

DBGET integrated database retrieval system