KEGG   Burkholderia pseudomallei K96243: BPSS0820Help
Entry
BPSS0820          CDS       T00203                                 

Definition
tRNA synthetase
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bps00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BPSS0820
Enzymes [BR:bps01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BPSS0820
Amino acid related enzymes [BR:bps01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BPSS0820
Transfer RNA biogenesis [BR:bps03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BPSS0820
 Prokaryotic Type
    BPSS0820
Mitochondrial biogenesis [BR:bps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BPSS0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:1104095..1106299
Genome map
AA seq 734 aa AA seqDB search
MSAPHADGARHAPPYRPQALEPRWQSAWRDARLFDADPQPGRPKWFIVELPPFATGQLHM
GHARNYVLADADARFRRMQGYNVLYTTGFDTFGLPTELAAREAGCAPERLARECSEAMAA
QFVRLGLGHDSRRITQYHVPAYYRWVQWVFLRLFEAGHCFRRDAPVAWCPQCEVTLAASL
VDDGRCWRCKRVVSTVVQPQWFVRESTFADEMLDGLDRLAGWPDEVKKIHRDWIGRREGL
RLRLPVRGRAHGLALHLDDAGWLPGVRFVAVGRRHPLAAAALRDGVQPGETILLADVAQA
AGAAGVVELPIIVEDAPGDAARAGRPDAVAADRALAERHALAAPSPGAGGAPAVCDLDAM
LAAGQAERVVGYRLQDWNIARNRYWGPPVPIVHCAACGPVAVPEHALPVRLPEDVDLSRP
GNPLEHHARFRDVRCPRCGASARRDAQTLEAYSSPWWYHWMCKRVDVDDPFNRDDANAWL
PVDLMIGGADQVRTCFFHVRMIARALRGMGIADVDEPVTTLLALGMVKQDDRKMSKSAGN
AVSLASIIERYGADALRLAIIGAAAPENDVNWSDDLVRRQRAFVARLWAFVHRVAETEAG
IAAAHDAGDPPAAGRPDALQRRMQDWLATGGRRIAADFRRHDYHLALKNLAFLFERLQAF
DAAMRRRAPPRAEDVAILAGATRQLVLFLGPFAPHVAEELWQALGGAGLVAGAAWPGADV
VRSSAATAKREAFA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccgcacgcggacggggcgcgccacgcgccgccgtatcggccgcaggcgctc
gagccgcgctggcagagcgcatggcgcgatgcgcgcttgttcgacgcggatccgcagccg
gggcggccgaagtggttcatcgtcgaattgccgccgttcgcgacgggccagttgcacatg
gggcacgcgcggaactacgtgctcgccgatgccgacgcgcggtttcggcgaatgcagggc
tacaacgtgctgtatacgacaggcttcgacacgttcggcctgccgaccgagctggccgcg
cgggaggcgggctgcgcgcccgagcgcctcgcgcgcgaatgcagcgaggcgatggccgcg
cagttcgtgcggctcgggctcgggcacgacagccggcgcatcacgcaatatcacgtgccg
gcgtactaccgctgggttcagtgggtgttcctgcggctgttcgaggccggccactgcttc
cggcgcgatgcgcctgtcgcgtggtgcccgcaatgcgaggtgacgctcgccgcgagcctc
gtcgacgacgggcggtgctggcgctgcaagcgcgtcgtcagcacggtcgtgcagccgcag
tggttcgtgcgcgaatcgacgttcgcggacgaaatgctcgacgggctggatcggctcgcg
ggctggcccgacgaagtgaagaagatccatcgcgactggatcggccggcgcgagggcctg
cgcttgcgcttgccggttcgcggccgcgcgcacgggctcgcgttgcacctcgacgatgcc
gggtggctgcccggagtgcggttcgtcgccgtcgggcggcggcatccgctcgccgccgcc
gcgcttcgcgacggggttcagcccggcgagacgatcctgctcgcggacgttgcgcaggcc
gccggcgcggcgggcgtcgtcgagctgccgatcatcgtcgaagacgcgcccggcgacgcg
gcgcgcgccggccgccccgacgcggtggcggcggaccgcgcgctcgccgagcggcacgcg
ctcgccgcgccgtcgcccggtgcgggcggcgcgcccgccgtgtgcgacctcgacgcgatg
ctcgccgcggggcaggccgagcgcgtcgtcggctaccggctgcaggactggaacatcgcc
cgcaaccgctactgggggccgcccgtgccgatcgtgcactgcgcggcgtgcggccccgtc
gcggtgcccgagcacgcattgcccgtgcggctgccggaggacgtcgatctgagccggccc
ggcaatccgctcgagcaccacgcgcgctttcgcgacgtgcgctgcccgcgctgcggcgcg
agcgcgcggcgcgacgcgcaaaccctcgaagcctattcgagcccgtggtggtaccactgg
atgtgcaagcgcgtcgatgtcgacgatccgttcaaccgcgacgacgcgaacgcatggctg
ccggtggatctgatgatcggcggcgccgaccaggtgcgaacctgcttcttccacgtgcgg
atgatcgcgcgcgcgctgcgcgggatgggcatcgccgatgtcgacgagcccgtgacgacg
ctgctcgcgctcggcatggtcaagcaggacgaccgcaagatgagcaagagcgcgggcaac
gcggtgagcctcgcatcgatcatcgagcgctacggcgccgacgcgctgcgcctcgcgatc
atcggcgcggccgcgcccgagaacgacgtcaactggtcggacgacctcgtgcgccggcag
cgcgcgttcgtcgcgcggctgtgggcgttcgtccaccgggtcgccgagaccgaagccggc
atcgccgccgcgcacgacgcgggcgatccgccggccgccggccggcccgatgcgctgcaa
cggcgaatgcaggattggctcgcgacgggcggccggcggatcgcggccgatttccggcgg
cacgactatcacctcgcgctcaagaatctcgcgttcctgttcgagcgcctgcaggcgttc
gacgcggcgatgcgcaggcgtgcgccgccgcgcgccgaggatgtcgcgatcctcgccggc
gcgacccggcaactggtgttgtttctcggcccgttcgcgccgcacgtcgccgaggagctc
tggcaggcgctcggcggcgcggggctggtggcgggcgccgcctggcccggcgcggacgtt
gtgcgctcatccgccgcgacggcgaaacgggaggccttcgcatga

DBGET integrated database retrieval system