KEGG   Burkholderia pseudomallei K96243: BPSS0853Help
Entry
BPSS0853          CDS       T00203                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BPSS0853
Enzymes [BR:bps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BPSS0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(1143269..1144201)
Genome map
AA seq 310 aa AA seqDB search
METIAVIGSNMVDLVTYVTRMPADGETLEAPNFELGCGGKGANQAVAASKLGARVAMISK
LGDDLFAENTLRNFERFGVDTEHVRRVSGVSSGVAPIFVSPDSRNRILIVKGANRHLRPA
DIDAAAAKIEASRLVVLQLEIDIDTVYYAIDFAAARGIPVLLNPAPGVPDLDFARLAKLE
FLVPNETELALVSGMPTDTPDAVERAAGSLVERGVKHVIVTLGEKGSLLVSRAGAVRVPP
VAVDARDTTGAGDAYIGCFARHYVATADIPAAMRLASAYAAHSVTGLGTQKSYADAATFE
RFLQTIGFGA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagacgatcgccgtcatcggcagcaacatggtcgatctcgtgacctacgtcacgcgg
atgcccgccgacggagaaacgctcgaagcgccgaacttcgagctcggctgcggcggcaag
ggcgcgaaccaggcggttgccgcgtcgaagctgggcgcgcgcgtcgcgatgatatcgaag
ctcggcgacgacctgttcgccgagaacacgctgcgcaacttcgagcgcttcggcgtcgat
accgagcacgtgcgccgcgtgagcggcgtatcgagcggcgtcgcgccgattttcgtgagc
cccgattcgcgcaaccgcatcctgatcgtcaagggtgcgaaccggcatctgaggccggcc
gacatcgacgcggccgccgcgaaaatcgaggcgagccgcctcgtcgtgctgcaactcgag
atcgacatcgatacggtctactacgcaatcgatttcgccgccgcccgcggcattccggtg
ctgctgaatcccgcgccgggcgtcccggatctcgatttcgcgcgcctcgcgaagctcgag
ttcctcgtgccgaacgagaccgagctcgcgctcgtgtccggcatgccgaccgacacgccc
gacgccgtcgagcgcgcggcgggctcgctcgtcgagcgcggcgtgaagcacgtgatcgtc
acgctaggcgagaagggctcgctcctcgtgtcgcgcgcgggcgccgtgcgcgtgccgccc
gttgccgtcgacgcgcgcgacacgacaggcgcgggcgacgcgtacatcggctgcttcgcg
cgccactatgtcgcaacggccgacatacccgccgcgatgcggctcgcctccgcgtacgcc
gcgcactcggtgacgggcctcggcacgcagaagtcgtacgcggatgccgcgacgttcgag
cgcttcctgcagacgatcggcttcggcgcgtga

DBGET integrated database retrieval system