KEGG   Burkholderia pseudomallei K96243: BPSS1697Help
Entry
BPSS1697          CDS       T00203                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPSS1697 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPSS1697 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPSS1697 (trpA)
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPSS1697 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(2331539..2332354)
Genome map
AA seq 271 aa AA seqDB search
MSRIQNTFAALAAQGRKGLIPFITAGDPDPAKTVELMHALAEGGADVIELGVPFSDPMAD
GPVIQRSSERALAKGVTLHSVLDDVKRFRARDQKTPVVLMGYANPIERMGADAFAAAARD
AGVDGVLVVDYPPEESHDFAAKMRAAGIDPIFLLAPTSTDDRIAAVGQVASGYVYYVSLK
GVTGAANLDVSSIAGKIPAIKSRVPLPVGVGFGIRDAATARAVAEVADAVVIGSRLVQLL
EQAAPERAAAELAGFVAELRVAIDGAAKPAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcagaacacttttgccgcactcgccgcccaaggtcgcaaggggctgatt
ccgttcatcaccgcgggagacccggacccggcgaagaccgtcgagctgatgcacgcgctc
gccgaaggcggcgccgacgtgatcgagctcggcgtgccgttctccgatccgatggccgac
ggccccgtgatccagcgctcgtcggagcgcgcgctcgcgaaaggcgtgacgcttcacagc
gtgctcgacgacgtgaagcgctttcgcgcgcgcgaccagaagacgcccgtcgtgctgatg
ggctacgcgaatccgatcgagcgcatgggcgcggacgcattcgccgcggccgcgcgcgac
gcgggcgtcgacggcgtgctcgtcgtcgactatccgcccgaggaatcgcacgatttcgcc
gcgaagatgcgcgcggcgggcatcgatccgatcttcctgctcgcgccgacgtcgaccgac
gaccggatcgccgccgtcggccaggtggcgagcggctacgtctactatgtgtcgctcaag
ggggtgacgggcgccgcaaatctggatgtttccagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccgcttcccgtcggggtcggtttcggcatccgcgacgccgcgacggcg
cgcgcggtggccgaggtggcggacgccgtcgtgatcggcagccgccttgtccagctgctg
gagcaggccgcgccggagcgggccgccgccgagctcgcggggttcgtcgccgagctgcgc
gtcgcgatcgacggcgcggcgaagccggcggcatga

DBGET integrated database retrieval system