KEGG   Burkholderia pseudomallei K96243: BPSS1697Help
Entry
BPSS1697          CDS       T00203                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00260  Glycine, serine and threonine metabolism
bps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01130  Biosynthesis of antibiotics
bps01230  Biosynthesis of amino acids
Module
bps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPSS1697 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPSS1697 (trpA)
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPSS1697 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Peripla_BP_6 His_biosynth B12-binding BtpA Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 3096324
NCBI-ProteinID: YP_111702
UniProt: Q63JM0
Position
2:complement(2331539..2332354)
Genome map
AA seq 271 aa AA seqDB search
MSRIQNTFAALAAQGRKGLIPFITAGDPDPAKTVELMHALAEGGADVIELGVPFSDPMAD
GPVIQRSSERALAKGVTLHSVLDDVKRFRARDQKTPVVLMGYANPIERMGADAFAAAARD
AGVDGVLVVDYPPEESHDFAAKMRAAGIDPIFLLAPTSTDDRIAAVGQVASGYVYYVSLK
GVTGAANLDVSSIAGKIPAIKSRVPLPVGVGFGIRDAATARAVAEVADAVVIGSRLVQLL
EQAAPERAAAELAGFVAELRVAIDGAAKPAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcagaacacttttgccgcactcgccgcccaaggtcgcaaggggctgatt
ccgttcatcaccgcgggagacccggacccggcgaagaccgtcgagctgatgcacgcgctc
gccgaaggcggcgccgacgtgatcgagctcggcgtgccgttctccgatccgatggccgac
ggccccgtgatccagcgctcgtcggagcgcgcgctcgcgaaaggcgtgacgcttcacagc
gtgctcgacgacgtgaagcgctttcgcgcgcgcgaccagaagacgcccgtcgtgctgatg
ggctacgcgaatccgatcgagcgcatgggcgcggacgcattcgccgcggccgcgcgcgac
gcgggcgtcgacggcgtgctcgtcgtcgactatccgcccgaggaatcgcacgatttcgcc
gcgaagatgcgcgcggcgggcatcgatccgatcttcctgctcgcgccgacgtcgaccgac
gaccggatcgccgccgtcggccaggtggcgagcggctacgtctactatgtgtcgctcaag
ggggtgacgggcgccgcaaatctggatgtttccagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccgcttcccgtcggggtcggtttcggcatccgcgacgccgcgacggcg
cgcgcggtggccgaggtggcggacgccgtcgtgatcggcagccgccttgtccagctgctg
gagcaggccgcgccggagcgggccgccgccgagctcgcggggttcgtcgccgagctgcgc
gtcgcgatcgacggcgcggcgaagccggcggcatga

DBGET integrated database retrieval system