KEGG   Burkholderia pseudomallei K96243: BPSS1699Help
Entry
BPSS1699          CDS       T00203                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00260  Glycine, serine and threonine metabolism
bps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01130  Biosynthesis of antibiotics
bps01230  Biosynthesis of amino acids
Module
bps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPSS1699 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPSS1699 (trpB)
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPSS1699 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3096325
NCBI-ProteinID: YP_111704
UniProt: Q63JL8
Position
2:complement(2333256..2334449)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFKNDPEFVAEYNRELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIGQALLAKRMGKRRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataaccttcccgatgatcgcggccatttcggcccatatggcggcgtgttcgtcgcc
gaaacgctgattcacgcgctcgacgagctgcgtgccgcgtacgagaaattcaagaacgac
cccgagttcgttgccgaatacaaccgtgagctgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaggatctgaaccacacgggcgcgcacaaggtgaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaagcggcgcgtgatcgccgagacgggcgcgggccagcacggcgtc
gccaccgcgacgatctgcgcgcgcttcggcatggagtgcgtcgtctacatgggcgccgag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctcggcgcgaccgtcgtg
cccgtcgaatccggctcgcgcacgctgaaggatgcgttgaacgaggcgatgcgcgactgg
gtcacgaacatcgagcgcacgttctacatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgccc
gagctcgccggccggcagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atgggcatcttctacccgtacatcgacgacgcggccgtccaattgatcggcgtcgaggcg
gcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgcacgtatctgctgcaggacgacgacggccagatcatcgagacg
cattcggtatcggccggcctcgactatccgggcgtcggccccgagcatgcctggctgaag
gacagcggccgcgcgcagtacgtcgggatcaccgacgaagaggcgctgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgaatcgagccacgcgatcgcctac
ggcgtgaagctcgcgccgacgctgccgaaggacaagatcctcctcgtcaacctgtcgggg
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcacgctctga

DBGET integrated database retrieval system