KEGG   Burkholderia pseudomallei K96243: BPSS1719Help
Entry
BPSS1719          CDS       T00203                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00020  Citrate cycle (TCA cycle)
bps00190  Oxidative phosphorylation
bps00650  Butanoate metabolism
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01200  Carbon metabolism
Module
bps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bps_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPSS1719
   00650 Butanoate metabolism
    BPSS1719
  Energy metabolism
   00190 Oxidative phosphorylation
    BPSS1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-GeneID: 3096506
NCBI-ProteinID: YP_111725
UniProt: Q63JJ7
Position
2:complement(2358556..2358924)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgcacactatggtctg
cgcgactggctggcgcagcgcgtcaccgcgagcgtgatggcgatctacaccgtcatcctg
ctcgtctggttcttcatcgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctttcgctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacatcaagcccgtcggtgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system