KEGG   Burkholderia pseudomallei K96243: BPSS1808Help
Entry
BPSS1808          CDS       T00203                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BPSS1808 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPSS1808 (mhpF)
   00650 Butanoate metabolism
    BPSS1808 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BPSS1808 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPSS1808 (mhpF)
   00622 Xylene degradation
    BPSS1808 (mhpF)
   00621 Dioxin degradation
    BPSS1808 (mhpF)
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BPSS1808 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(2467265..2468158)
Genome map
AA seq 297 aa AA seqDB search
MKSKSSRTRVAILGSGSIGLDLMFKVKASEQFDLKFVVGRNANSDGLRLARSCNVETSSD
GLDFLKAHEDAYDLVFDATSAAAHKVNNRFFSDAGKFVIDLTPAKVGRLCVPCINLDDMG
AEQNVNLITCGGQASLPLAYALKQAVDEIDYLEVVSAIASRSAGIATRENIDEYMTTTEY
ALAKFSDAKKTKAILNINPAEPGVRMQTTLYAYARYRDFDRVRASVADMVEKVREYVPGY
RLVVEPLESQGRITIGLTVRGRGDYLPEYAGNLDIINCAALAVASHRHATARLGATQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaagtcatcgcgcacgcgggtggcgatcctgggctcgggcagcatcgggctc
gatctgatgttcaaagtcaaggcatccgagcaattcgatctgaagttcgtcgtcggacgc
aatgcgaacagcgacgggctgcggctcgcgcgcagttgcaacgtggagacatcgagcgac
ggtctcgattttctgaaggcgcacgaggatgcgtacgacctcgtgttcgacgcgacatcg
gccgccgcgcacaaggtcaacaaccgcttcttctccgacgcgggcaagttcgtgattgat
ctgacgcccgcgaaggtcggccgcctgtgcgtgccgtgcatcaatctggacgacatgggc
gccgagcagaacgtgaacctgatcacctgcggcgggcaggcgagcctgccgctcgcgtac
gcgctgaagcaggcggtcgacgagatcgattacctggaggtggtgtcggcgatcgcgtcg
cgcagcgccggcatcgcgacgcgcgagaacatcgacgaatacatgacgacgaccgagtac
gcgctcgcgaaattcagcgatgcgaagaagacgaaggcgatcctcaacatcaatccggcc
gagcccggtgtgcggatgcagacgacgctctatgcgtacgcgcgctatcgcgatttcgac
cgcgtgcgcgcaagcgttgccgacatggtcgagaaggtgcgcgaatacgtgcccggctat
cggctcgtcgtcgagccgctcgaaagccaggggaggatcacgatcggtctcaccgtgcgc
gggcgcggcgactatctgcccgagtacgcgggcaatctggacatcatcaactgcgcggcg
ctcgcggtcgcctcgcatcggcacgcaaccgccagactaggagccacacaatga

DBGET integrated database retrieval system