KEGG   Burkholderia pseudomallei K96243: BPSS1870Help
Entry
BPSS1870          CDS       T00203                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:bps00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPSS1870
Enzymes [BR:bps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BPSS1870
Two-component system [BR:bps02022]
 CheA family
  WspE-WspRF
   BPSS1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(2540279..2541307)
Genome map
AA seq 342 aa AA seqDB search
MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQPPDLVLMDLVMPRID
GVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDTPTLEQGGSADPSQPLL
AKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGPTALTALLRRLPDDFPAA
LVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVLLAATNDHLHLTSRGVLAY
TRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGALGLKAMRTKGHYTIAQDEA
TSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQRWR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgacttgccgctcgccgtcgaggcgctgcgccgcacgatc
gcgctgcggcccgagcaccgcgtgctgtgggtcgcgacggacggcgcgcaggcgctcgac
ttctgcgtcgcgcagccgccggacctcgtcctgatggatctcgtgatgccgcgcatcgac
ggcgtatcggcgacgcgcagcatcatggagcgctcgccgtgcgcgatcctcatcgtcacc
gcgaacgtcggcgcgaacgcgtcgtacgtctacgaggcgatgggcgcgggcgcgctcgac
gcggtcgacacgccgacgctcgagcagggcggcagcgccgatccgtcgcagccgctgctc
gcgaagatcgaccagatcggccggctgctcgcgacgcgtatgccgctcgccgcgcccgcc
gccgccgcgcccgcgccgcagggcgcgttgccgccgctcgtcgcgatcggcgcgtcggcg
ggcgggccgaccgcgctgaccgcgctgctgcggcggctgccggacgattttccggcggcg
ctcgtgatcgtccagcatgtcgaccaggcgttcgcgatcggcatggcgcagtggctcgac
ggctattcgccgttgccggtgcgcatcgcgcggcagggcagcgtgccgcaggcgggtgag
gtgctgctcgcggcgaccaacgatcacctgcatctgacgtcgcgcggggtgctcgcgtac
acgcggcgtccggaagagacgccgtaccggccgtcggtcgacgtgttctttcacagcgtc
gtcgatcactggaagggcgaggcgatcggcgtgctgctcacgggcatggggcgcgacggc
gcgctcggcctgaaggcgatgcgcacgaaggggcattacacgatcgcgcaggacgaagcg
acgagcgcggtgtacgggatgccgaaggccgcggccgcgatcggcgcggcgagcgcggtg
ctgccgctcgagcggatcgccgatcagttgatctcgctcgttcagcgcaacaggcagcgc
tggcgctga

DBGET integrated database retrieval system