KEGG   Burkholderia pseudomallei K96243: BPSS1918Help
Entry
BPSS1918          CDS       T00203                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00010  Glycolysis / Gluconeogenesis
bps00071  Fatty acid degradation
bps00350  Tyrosine metabolism
bps00625  Chloroalkane and chloroalkene degradation
bps00626  Naphthalene degradation
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSS1918
  Lipid metabolism
   00071 Fatty acid degradation
    BPSS1918
  Amino acid metabolism
   00350 Tyrosine metabolism
    BPSS1918
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPSS1918
   00626 Naphthalene degradation
    BPSS1918
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BPSS1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 3096927
NCBI-ProteinID: YP_111924
UniProt: Q63IZ8
Position
2:complement(2599462..2600448)
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGGAPRLREAELPDPVPAAGQLLIDVHACGVCRTDLHVVDGDLRDPKRPVIPGH
EIVGTVAALGALAKGFTIGERVGVPWLGRTCGHCAYCASGRENLCDAPGFTGYTIDGGYA
QRTVADARFCVHVPSRYDDIHAAPLLCAGLIGYRTLKMAGSARRIGLYGFGAAAHLVAQV
ARFQGRTVYAFTRPGDAAAQRLARRLGAAWAGGSDEAAPEPLDAALIFASVGALVPAALA
AVVKGGAVVCGGIHMSDIPSFSYDLLWGERRIVSVANLTRDDAAEFMRIANDVPLDVEAT
PYPLAQANQALDDLRAGRLAGAAVLTMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtattcgacggcggcgcgccgcggctgcgcgaagccgagctgccggac
cccgtgccggcggcggggcaactgctgatcgacgtgcacgcgtgcggcgtgtgccggacc
gatctgcacgtcgtcgacggcgatctgcgcgatccgaagcggccggtgattccggggcac
gagatcgtcggcacggtggccgcgctcggcgcgctcgcgaagggtttcacgatcggcgag
cgtgtcggcgtgccttggctcgggcgcacgtgcggccattgcgcgtactgcgcgagcggc
cgcgagaacctgtgcgatgcgcccggcttcaccggctacacgatcgacggcggctatgcg
cagcgcacggtcgccgacgcgcgcttttgcgtgcacgtgccgagccgctacgacgatatt
catgcggcgccgctgctgtgcgcgggtctcatcggctaccggacgctgaagatggccggt
tccgcgcggcgcatcggcctgtacggattcggcgcggccgcgcacctcgtcgcgcaggtc
gcgcgttttcaggggcgcaccgtttatgcgttcacgcgcccgggcgacgccgccgcacag
cggctcgcgcgccggctcggcgccgcgtgggcgggcggcagcgacgaagccgcgcccgag
ccgctcgatgcggcgctgatcttcgcatcggtcggcgcgctcgtgccggccgcgctcgcg
gcggtcgtgaagggcggcgccgtcgtgtgcggtgggattcacatgtcggacattccgtcg
ttttcgtacgatttgttgtggggcgagcggcggatcgtatcggtcgcgaacctgacgcgc
gacgacgcggccgaattcatgcggattgcgaacgacgtgccgctcgacgtggaggcaacg
ccgtatccgctcgcgcaggcgaaccaggcgctcgacgatctgcgcgccggacgtctggcc
ggggcggcggtgttgacgatgcgctag

DBGET integrated database retrieval system