KEGG   Burkholderia pseudomallei K96243: BPSS1944Help
Entry
BPSS1944          CDS       T00203                                 

Gene name
adhA
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00010  Glycolysis / Gluconeogenesis
bps00071  Fatty acid degradation
bps00350  Tyrosine metabolism
bps00625  Chloroalkane and chloroalkene degradation
bps00626  Naphthalene degradation
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSS1944 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BPSS1944 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BPSS1944 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPSS1944 (adhA)
   00626 Naphthalene degradation
    BPSS1944 (adhA)
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BPSS1944 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 3096266
NCBI-ProteinID: YP_111950
UniProt: Q63IX2
Position
2:complement(2631078..2632103)
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
YGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAPQKLELARKLGAAFVVDASKDDPAAVIQKEIGGVHGVLV
TAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtgcatgcattcggcgaaccgcttcggatcgag
gaggtgcccgtgccgacgcccggcgcggggcagattctcgtgaacgtcaaggcatcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtcgcggcggtgggcgaaggcgtgaggcac
gtgaaggagggcgatcgcgtcggcgtgccttggctctataccgcgtgcggccattgcgag
tattgccagaccggctgggagacgctgtgccacgagcagcagaacaccggctattcggtg
tacggcagctacgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgggtgaccgacacgcgcccggggcaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtgcagtacgcgaaggcgatggggctgcacgtggtcgcggtggacgtc
gcgccgcagaagctcgagcttgcgcgcaagctgggcgcggcgttcgtcgtcgatgcgtcg
aaggacgatccggcggcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcggcgcgttcgcgcaggcgctcggcatggtgaggcgcggcgggacg
gtctcgctgaacgggctgccgccgggcgattttccgctgccgatcttctcgacggtgctc
aacgggatcacggtgcgaggctcgatcgtcggcacgcggcgcgatctccaggaatcgctc
gatttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctcgagcacatc
aacggcgtgttctcggcgctgcgtgaagggaaggtcgacgggcggatcgtgttgaccggg
caatga

DBGET integrated database retrieval system