KEGG   Burkholderia pseudomallei K96243: BPSS1957Help
Entry
BPSS1957          CDS       T00203                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPSS1957
   01230 Biosynthesis of amino acids
    BPSS1957
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSS1957
   00030 Pentose phosphate pathway
    BPSS1957
   00051 Fructose and mannose metabolism
    BPSS1957
   00052 Galactose metabolism
    BPSS1957
  Energy metabolism
   00680 Methane metabolism
    BPSS1957
Enzymes [BR:bps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BPSS1957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(2645187..2646128)
Genome map
AA seq 313 aa AA seqDB search
MPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYL
AGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGPALAAHEWPR
CVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGPALAAALDAG
VYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGALVVSRDDAVR
LPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTGTALGTKEDI
ARIYRELPGTIDA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaatcgtcaccctcacgccgaatcccgccatcgacgtcgcgacgtgcgtcgag
cgagtcaccgacacccgcaagctgcgctgcggccccgcacgacgcgatccgggcggcggc
ggaatcaatgtcgcccgcgtgctgacgcgcctcggcgccgattgttcggccgtctacctg
gcgggcggcggcaccggcctcgcgctgcgcggcctgctcgccgacgaaggcgtgcgggcg
catggcatcgacatcgccggcgagacgcgcgaaaacttttcggtgctcgaaacgtcgacg
ggccgcgaattccgcttcgtgttgcccgggccggcgctcgcggcgcacgaatggccgcgc
tgcgtcgaagcgctcgggcggctcgccgacgcgtcgcgctatctggtgatgagcggcagc
ctgccgcccggcatgccggacgattgctacgcccggctcgcgcggcgcgcgagcgcgcgc
ggcgtgcgcacggtcgtcgatacgtcggggccggcgctcgccgccgcgctcgatgcgggc
gtctatctggtgaagccgagcctcggtgagttgcgcgcgctgaccggcctgccgctcgaa
gacgacggcgcgcgccttgccgccgcgcgcgcgatcgtcgccggcgggcgcgcgcagatc
gtcgcgctgacgctcggcgacgcgggcgcgctcgtcgtgtcgcgcgacgatgcggtgcgt
ctgccgggcgtgaaggtggcggtgcgcagcgcgatcggcgcgggcgacagcttcgtcgcg
gggctcgtcgccgcgctcaatcgcggcgcgaacgtcgccgacgcggcgcgccatgcgctc
gccgccgcgtcggcgtcgctgctgagcacgggcaccgcgctgggcacgaaggaagacatc
gcgcggatctatcgcgaactgccggggacgatcgacgcgtga

DBGET integrated database retrieval system