KEGG   Burkholderia pseudomallei K96243: BPSS2081Help
Entry
BPSS2081          CDS       T00203                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bps00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bps00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bps00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(2816328..2818499)
Genome map
AA seq 723 aa AA seqDB search
MFDTKLIRLTGSNLSIALEKSADMPPVWRYFGAKLEPHAIAWSADDVRPHPPTLLDGDPP
FTAFSTHGFGWFHQPALVGSRPGDVGDIDWAQSFRLDEVSTNDHSVTMKLSDEQAELGAI
LSYTIDPASDVITMWAELENRGATPFRVDWLAAATVPLPPDANRALSFSGRWTLEFQENR
EILGSATWRRDNRRGRTSHDSFPGVMVGSSLADNVGTVYGAHLGWSGNHTIIIEPMTDGR
RQLQLGEWLAPGEVVLAPDQRYRTPCAFLSYSEQGLNGLSAQFHRFVRAKVLRWPRQRMQ
PRPVILNTWEAVYCDHDLEDLKELATAGAQIGIERFVLDDGWFHCRDNDRAGLGDWWPDA
NKYSRGLTPLIHHVRDLDMDFGLWIEPEMVNPDSELYRARPEWTLRLDGRPLVTGRNQLV
LDLAEPDVREYLFTQISALLRDNAISYLKWDMNRDLATAGHRGMPAYRRQTQAFYALLDR
LRAAFPAVEIESCASGGGRADYGVLARMHRLWTSDCNDALTRIGIQRGFLRFFPPELMGA
HIGADRSHTTGRRHTLAFRAAVALFGHLGVEVDPRAMPADEIEALMRWIAIYKEWRPVLH
AGTLHQGCISEALSWTQAVSDDGSASLLAIYRLREDNARYATPLKIKGLRCDIAYRVQTL
YAPVAPHFVKQTQMFKMMQNEGVVISGASLLELGMPIPPMPPESAVVISLKPASELSKPL
DLY
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacaaaacttattcgattgactggttcaaatctcagcatcgcactagagaaa
tcggccgatatgccgcctgtatggcgctattttggcgcaaaattagaaccgcacgccatc
gcctggagcgcagacgacgtgcgaccgcaccctccgacgttactcgacggcgatccgccc
ttcacggcattctcgacacacggattcggctggttccatcaaccggcactcgtcggcagc
cggcctggagacgttggcgatattgactgggcacagagctttcgccttgatgaggtaagc
acaaacgatcactcggtaacaatgaagttgagcgacgaacaggccgagttgggtgcaatc
cttagttacacaatcgatcctgcgtcggacgtcataacgatgtgggctgaattagagaac
cgcggcgcgactccattccgtgtagattggctagccgccgccactgtaccgctgccgccc
gacgcaaatcgggcactgagcttctcggggcgctggacgctggagttccaggaaaatcgt
gaaattctcggttctgcgacgtggaggcgcgacaaccgacgcgggcgcacttctcacgac
tcgtttccgggagtcatggtcggctcatcgctagcggacaatgtgggcaccgtatacggc
gcgcatttgggatggagtggaaaccacaccatcatcatcgaaccgatgaccgatggtcgc
cggcaactgcaattgggggaatggttggcaccgggcgaagtcgtgcttgcaccggaccaa
cgctatcgcacaccatgcgcctttctttcatacagcgagcagggcctgaatggcttgagc
gcgcagttccaccgcttcgttcgggcgaaggtactgcgctggccacggcaacgcatgcaa
cctcggccggtgatcctcaatacttgggaagccgtatattgcgatcacgatctcgaggat
ctcaaggaactggcgactgcgggggcgcagatcggcatcgaacgtttcgttctcgacgac
ggctggttccattgccgcgacaacgatcgcgccggactaggcgactggtggcccgatgcg
aacaagtactctcgcgggctcacaccactcatccatcacgttcgagatttggacatggac
tttggcctatggatcgaacccgaaatggtcaatccggacagcgaattgtaccgcgcccgc
ccggagtggacgcttcggctcgacggtcggccactcgtgacaggtcgcaatcagctcgta
ctggacctcgcggaaccagatgtgcgcgaatatctcttcacgcaaatcagtgctttattg
cgcgacaatgcgatttcctatctcaaatgggatatgaaccgagatctcgccacggctggc
catcgtggcatgcccgcttacaggcgtcagacccaggcgttttatgcgttgctcgatcgg
ttgcgcgccgcgtttcctgctgtggagatcgagagttgcgcctccgggggcggacgagcc
gattacggtgtgttggctcgcatgcaccgtctctggacgagcgactgcaatgacgcgctc
acgcgcatcggaattcagcgcggctttctgcgtttctttcctcccgagctcatgggtgca
catatcggggccgatcgttcccacacgaccggacgccggcacactcttgctttcagagcc
gcagtcgcacttttcggtcaccttggcgttgaagtcgacccgagagcaatgcccgccgac
gagatcgaagccctcatgcgctggattgcaatatacaaggaatggcggcccgttctacat
gcgggaacccttcaccaggggtgtatcagcgaggcgctctcttggactcaagctgtctcc
gatgacggaagtgcgtcgcttttggcgatctatcgactacgcgaggacaacgcgcgatac
gccacaccactcaagatcaagggactgagatgcgacatcgcctatcgagtacaaacgctc
tacgcacctgtcgcaccacatttcgtgaagcaaacgcaaatgttcaagatgatgcagaac
gaaggcgtggtgatttcgggcgcaagtttgctggagttagggatgccaattcctcccatg
ccgcccgaatccgccgttgtgatttcgctaaaacccgcctcggagttatccaaaccgctt
gatctgtattaa

DBGET integrated database retrieval system