KEGG   Burkholderia pseudomallei K96243: BPSS2081Help
Entry
BPSS2081          CDS       T00203                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BPSS2081
  Lipid metabolism
   00561 Glycerolipid metabolism
    BPSS2081
   00600 Sphingolipid metabolism
    BPSS2081
Enzymes [BR:bps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BPSS2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:complement(2816328..2818499)
Genome map
AA seq 723 aa AA seqDB search
MFDTKLIRLTGSNLSIALEKSADMPPVWRYFGAKLEPHAIAWSADDVRPHPPTLLDGDPP
FTAFSTHGFGWFHQPALVGSRPGDVGDIDWAQSFRLDEVSTNDHSVTMKLSDEQAELGAI
LSYTIDPASDVITMWAELENRGATPFRVDWLAAATVPLPPDANRALSFSGRWTLEFQENR
EILGSATWRRDNRRGRTSHDSFPGVMVGSSLADNVGTVYGAHLGWSGNHTIIIEPMTDGR
RQLQLGEWLAPGEVVLAPDQRYRTPCAFLSYSEQGLNGLSAQFHRFVRAKVLRWPRQRMQ
PRPVILNTWEAVYCDHDLEDLKELATAGAQIGIERFVLDDGWFHCRDNDRAGLGDWWPDA
NKYSRGLTPLIHHVRDLDMDFGLWIEPEMVNPDSELYRARPEWTLRLDGRPLVTGRNQLV
LDLAEPDVREYLFTQISALLRDNAISYLKWDMNRDLATAGHRGMPAYRRQTQAFYALLDR
LRAAFPAVEIESCASGGGRADYGVLARMHRLWTSDCNDALTRIGIQRGFLRFFPPELMGA
HIGADRSHTTGRRHTLAFRAAVALFGHLGVEVDPRAMPADEIEALMRWIAIYKEWRPVLH
AGTLHQGCISEALSWTQAVSDDGSASLLAIYRLREDNARYATPLKIKGLRCDIAYRVQTL
YAPVAPHFVKQTQMFKMMQNEGVVISGASLLELGMPIPPMPPESAVVISLKPASELSKPL
DLY
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacaaaacttattcgattgactggttcaaatctcagcatcgcactagagaaa
tcggccgatatgccgcctgtatggcgctattttggcgcaaaattagaaccgcacgccatc
gcctggagcgcagacgacgtgcgaccgcaccctccgacgttactcgacggcgatccgccc
ttcacggcattctcgacacacggattcggctggttccatcaaccggcactcgtcggcagc
cggcctggagacgttggcgatattgactgggcacagagctttcgccttgatgaggtaagc
acaaacgatcactcggtaacaatgaagttgagcgacgaacaggccgagttgggtgcaatc
cttagttacacaatcgatcctgcgtcggacgtcataacgatgtgggctgaattagagaac
cgcggcgcgactccattccgtgtagattggctagccgccgccactgtaccgctgccgccc
gacgcaaatcgggcactgagcttctcggggcgctggacgctggagttccaggaaaatcgt
gaaattctcggttctgcgacgtggaggcgcgacaaccgacgcgggcgcacttctcacgac
tcgtttccgggagtcatggtcggctcatcgctagcggacaatgtgggcaccgtatacggc
gcgcatttgggatggagtggaaaccacaccatcatcatcgaaccgatgaccgatggtcgc
cggcaactgcaattgggggaatggttggcaccgggcgaagtcgtgcttgcaccggaccaa
cgctatcgcacaccatgcgcctttctttcatacagcgagcagggcctgaatggcttgagc
gcgcagttccaccgcttcgttcgggcgaaggtactgcgctggccacggcaacgcatgcaa
cctcggccggtgatcctcaatacttgggaagccgtatattgcgatcacgatctcgaggat
ctcaaggaactggcgactgcgggggcgcagatcggcatcgaacgtttcgttctcgacgac
ggctggttccattgccgcgacaacgatcgcgccggactaggcgactggtggcccgatgcg
aacaagtactctcgcgggctcacaccactcatccatcacgttcgagatttggacatggac
tttggcctatggatcgaacccgaaatggtcaatccggacagcgaattgtaccgcgcccgc
ccggagtggacgcttcggctcgacggtcggccactcgtgacaggtcgcaatcagctcgta
ctggacctcgcggaaccagatgtgcgcgaatatctcttcacgcaaatcagtgctttattg
cgcgacaatgcgatttcctatctcaaatgggatatgaaccgagatctcgccacggctggc
catcgtggcatgcccgcttacaggcgtcagacccaggcgttttatgcgttgctcgatcgg
ttgcgcgccgcgtttcctgctgtggagatcgagagttgcgcctccgggggcggacgagcc
gattacggtgtgttggctcgcatgcaccgtctctggacgagcgactgcaatgacgcgctc
acgcgcatcggaattcagcgcggctttctgcgtttctttcctcccgagctcatgggtgca
catatcggggccgatcgttcccacacgaccggacgccggcacactcttgctttcagagcc
gcagtcgcacttttcggtcaccttggcgttgaagtcgacccgagagcaatgcccgccgac
gagatcgaagccctcatgcgctggattgcaatatacaaggaatggcggcccgttctacat
gcgggaacccttcaccaggggtgtatcagcgaggcgctctcttggactcaagctgtctcc
gatgacggaagtgcgtcgcttttggcgatctatcgactacgcgaggacaacgcgcgatac
gccacaccactcaagatcaagggactgagatgcgacatcgcctatcgagtacaaacgctc
tacgcacctgtcgcaccacatttcgtgaagcaaacgcaaatgttcaagatgatgcagaac
gaaggcgtggtgatttcgggcgcaagtttgctggagttagggatgccaattcctcccatg
ccgcccgaatccgccgttgtgatttcgctaaaacccgcctcggagttatccaaaccgctt
gatctgtattaa

DBGET integrated database retrieval system