KEGG   Burkholderia pseudomallei K96243: BPSS2165Help
Entry
BPSS2165          CDS       T00203                                 

Definition
hypothetical protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bps  Burkholderia pseudomallei K96243
Brite
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BPSS2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:2927755..2928762
Genome map
AA seq 335 aa AA seqDB search
MTDTQRDLVLVTGASGFVGSAVARAARRQGYRVRVLVRPTSPRTNVADLDAEIATGDMRD
EASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSV
ATLKVTPSGASADESSPLAAGQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAQGHLLALERGRVGERYILGGENL
PLQAMLADIAQSTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacacaacgcgatctcgttctggtgaccggcgcatccggttttgtcggctcc
gccgtcgcgcgcgccgcgcggcggcagggctatcgggtgcgcgtgctcgtgcggccgacg
agcccgcgcacgaacgtcgcggatctcgacgccgagatcgccaccggcgacatgcgcgac
gaggcatcgatgcgcgccgcgctgcgcggcgtgcgccatctgctgcacgtcgccgccgac
taccggctgtgggcgcccgatccgctcgagatcgagcgcgcgaatctcgaaggcgcggtc
gcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacgagcagcgtc
gccacgctgaaggtgacgccgtcgggcgcctcggccgacgaatcgtcgccgctcgccgcc
gggcaggcgatcggcgtatacaagcgcagcaaggtgctcgccgagcgcgcggtcgagcgg
atgatcgccgaggacgggctgcccgcggtgatcgtcaatccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccggatcatcgtcgaggcggcgctcggcaagatc
ccggcgttcgtcgacacggggctgaacctcgtgcacgtcgacgacgtcgcgcagggccac
ctgctcgcgctcgagcgcgggcgcgtcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcaggcgatgctcgccgacatcgcgcaatcgacgggacgcaagccgccgacgatc
gcgctgccgcgctggccgctgtatccgatcgcgctcggcgcggaggcggtggcgaagctg
acgaagcgcgagccgttcgtgacggtcgacgggctcaggatgtcgaagaacaagatgtat
ttcacgtccgcgaaagccgagcgcgagctcggctaccgcgcgcggccgtaccgcgaaggc
attcgcgacgcgctcgactggttcaggcaggcgggctatctgcgctga

DBGET integrated database retrieval system