KEGG   Burkholderia pseudomallei K96243: BPSS2278Help
Entry
BPSS2278          CDS       T00203                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BPSS2278
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BPSS2278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2:3060560..3062218
Genome map
AA seq 552 aa AA seqDB search
MKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWR
PALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMP
AHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYAD
PYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDA
RADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDAL
GKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVL
TRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKR
RWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGA
AMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQ
RWDSTAETPVAA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagtcctacgattacgactacgtcgtggtcggctccggcttcggcggcagc
gtctcggcgctgcgtctgtccgagaaaggctatcgtgtgctcgtgatcgagcagggccgt
cgctggacgcccgagaacctgccggaaagcacgtggaacctgtcgcgctggcaatggcgc
cccgcgctcgggctgcgcggcttcttcagcatgcgctttttcaggcacgtcgtcgtgctg
cacggcaatgcggtgggcggcggctcgatcacgtacgcgaacacgctgctcgtgccgccc
gacaaggtctggcgcgagggcacatgggccggcctcgaggactgggagcgcgtgatgccc
gcgcactacgccaccgcgaagcgcatgctcggcgtcgtcacgaaccggcgaatggatgcg
gccgacttccggctgaaggacatggcgaagctgatcggcgtcgagaagagtttctatccg
accgaggtcggcgtgttcttcggcgacgacgccgacgcgcccggcacgcgctacgccgat
ccgtacttcggcggcgcgggcccggagcgcacgtcgtgcatcggctgcggcggctgcatg
gtcggctgccgccacggcgcgaagaacacgctcgaccgcaattacctgtatctcgccgag
cgcctcggcgcgcaggtgcgcgagcagacgaaggtcgtcgacgtgcgcccgctcgacgcg
cgcgccgacggcgcggcgggctacgcggtcgaagcggtgtcgctcgcggcgggcgcgcgc
ggcgcgaaaagccgcctcacgtgccgcggcgtcgtgttcgccgcatcctcgctcggcacg
caggatctgctgatgcgcctgaaggaaaagggctcgctgccccggctgtcggacgcgctc
ggcaagcgcgtgcgcacgaacgccgaatcgctgatcggcgtgcgctttccgaaatcgcgc
gtcgatctgtcgaagggcgtggcgatcggctcgggcatctacatcgacgagcacacgcac
atcgaggccacccgctatccttcgggctccgacacgatggggctgctcacgaccgtgctc
acgcgcggcgcgccgggcggcctgcgtgtgctcgtgtggctcggcgcgctcgcgaagctc
gttctcacgcgaccgctgagcgcgtggcggatgatcgacccgcgcggcttcgcgcgcgag
acgatgatcttcctctgcatgcagacgctcgaaggacacctgacgatgcgcctgaagcgc
cgctggttctggccgttctcgaagcagctcgcgacctccggcgcgaagatccccgcctac
attccggccgcgaacgacttcgcgcagaaggccgcgcgcgcgctcggcggcgtgccgatg
acctcgctcaccgagatcctgctgaacgtgccgatgaccgcgcattgcatgggcggcgcg
gcgatggcgcgcgacgcgcgcgacggcgtgtgcgacggccgcagccgcgtgttcggctat
cggaacatgtacgtctgcgacggctcggtgctcggcgcgaacctcggcgtcaacccgagc
ctcacgatcacggcgctcgccgagcatgcgatgagccacgtgcccgccgcgcgcgagcag
cggtgggacagtaccgcggagacgcctgtcgcggcatga

DBGET integrated database retrieval system