KEGG   Burkholderia pseudomallei MSHR305: BDL_1179Help
Entry
BDL_1179          CDS       T02756                                 

Gene name
kynU
Definition
kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BDL_1179 (kynU)
Enzymes [BR:bpse01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BDL_1179 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1417665..1418915
Genome map
AA seq 416 aa AA seqDB search
MKTREEALALDRDDPLAPLREQFALPAGVVYLDGNSLGAQPRAAAARAQQVIGAEWGEGL
IRSWNTAGWFALPRRVGDRLAPLIGAADGEVAITDTISINLFKLLAAMLRHQARHAPKRR
VIVSERSNFPTDLYIAQGLIAQLDRDYELRLIDDPADLPDALDDETAVAMITHVNYRTGY
MHDMPSVTQTVRQAGALMLWDLAHSAGAVPVDLNGALADGAVGCTYKYLNGGPGSPAFVW
VPKRHQRAFEQPLSGWWGHRAPFAMQPAFEPDPGIARFLCGTQPIVSMSMVECGLDVFAQ
TDMHAIRRKSLALTDAFVALVESRCAGQPLKLVTPRAHHQRGSQASFEHPHGYEVMQALI
ARGVIGDYREPRILRFGFTPLYTRFVDVWDAVETLRDILDTEAWRAPEFATRAAVT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgtgaagaagcgctcgcgctcgaccgcgacgacccgctcgcgccgctgcgc
gagcagttcgcgctgcccgccggcgtggtctatctcgacggcaattcgctcggcgcgcag
ccgcgcgcggcggccgcccgcgcgcaacaggtgatcggcgccgaatggggcgaaggcctc
atccgcagctggaacacggccggctggttcgcgctgccgcgccgggtcggcgacaggctc
gcgccgctcatcggcgcggccgacggcgaggtcgcgatcaccgatacgatctcgatcaac
ctgttcaagctgctggccgcgatgctgcggcaccaggcgcggcacgcgccgaagcgccgc
gtgatcgtgtcggagcgctcgaacttcccgaccgacctgtacatcgcgcagggcctgatc
gcgcagctcgaccgcgactacgaactgcgcctcatcgacgatcccgccgatctgcccgac
gcgctcgacgacgagaccgccgtcgcgatgatcacccacgtgaactaccgcacgggctac
atgcacgacatgccgtccgtcacgcagacggttcgccaggccggcgcgctgatgctgtgg
gatctcgcgcattcggcgggcgccgtgcccgtcgatctgaacggcgcgctcgccgacggc
gcggtgggctgcacgtacaagtacctgaacggcggccccggctcgcccgcgttcgtctgg
gtgcccaagcgccatcagcgggcgttcgagcagccgctgtccggctggtggggccatcgc
gcgccgttcgcgatgcagcccgcgttcgagcccgatccgggcatcgcgcgctttctgtgc
ggcacgcagccgatcgtgtcgatgtcgatggtcgaatgcgggctcgacgtgttcgcgcag
accgacatgcacgcgatccgccgcaaatcgctcgcgctcaccgacgcattcgtcgcgctc
gtcgaatcgcgctgcgcgggccagccgctcaagctcgtcacgccgcgcgcgcatcatcag
cgcggctcgcaggcgagcttcgagcatccgcacggctacgaggtgatgcaggcgctgatc
gcgcgcggcgtgatcggcgactaccgcgagccgcgcatcctgcgcttcggcttcacgccg
ctctacacgcgcttcgtcgacgtgtgggacgcggtcgagacgctgcgcgacattctcgac
accgaggcatggcgcgcgcccgagttcgccacgcgcgccgcggtgacctga

DBGET integrated database retrieval system